TkA02G144230 | RubberDandelionOmics

Gene overview

TkA02G144230

Reference: TK1151 Chr: Chr02 Coordinates: 37271874-37274234 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1250 bp · TkA02G144230|TK1151|cDNA

AAACAATTCAGTCCGCGCCCTAATCCCGCTCCTCCATTCTTACAAAATCCCGCCTCCATCATCCTCGGTCCCAAAAAGAAACTGCTCTTCCTCTCGCCGGCATCATCGTTCACCGAGCTAGTCCACTCTCTGGCACAAAACCACACGCAGGCCGCAGCCTTCTTCTCCGACGATTCCCGCCTGCGCCGGCAGGCCTCGCGACTCCGGCTCCCGTATCTGCGTCAGTCAAGGACGCCGCAACAGCAGTCCTCGTCTCCTCG...

CDS

Download CDS FASTA

513 bp · TkA02G144230|TK1151|CDS

ATGCCGCCATTTGCCATAACTCCGAAAAGCTCTGGTTATTTCTCTGCTCTCACCCAAGAGATCGATAAAAAGCTCCATAGGGCAATAGCTTCAGCAACTCAGAGACGCGATTTATTACAAGCGCTGTTCGCAGACATAGCTTTAGAAGTTGATGATCGAGCCAGAGGATTTGTTGAAACTAGACAACAATTGCTGACTTTGAAACCAAATCACCGGATGAATTGGATTGGTTTTGCAGTTTCTCATCATTTAAACTCAAA...

Protein

Download Protein FASTA

170 aa · TkA02G144230|TK1151|PROTEIN

MPPFAITPKSSGYFSALTQEIDKKLHRAIASATQRRDLLQALFADIALEVDDRARGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNASKAIDILEAYEGTLEDDYPPESERCEHGEMLLYKISLLEECGLLEKALKELRKREFKIISWMLCINLLRNNTPGLLLLRGSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G144230`
TK1151 ID	TkA02G144230
OH-1004 ID	LXL04_024118
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 99.412 / OH-1004 44.357 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G144230

Location Chr02:37271874-37274234 (-)

Description Similar to NAA15: N-terminal acetyltransferase A complex auxiliary subunit NAA15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80410`	Auxiliary subunit of the NatA N-alpha-acetyltransferase complex.	Protein N-terminal acetylation is required for embryogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erw257 NatA is required for suspensor development in Arabidopsis.2016 · DOI: 10.1080/15592324.2016.1231293

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024118 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G80410

hsa:79612

mmu:66897

pon:100173970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.384

Rank 1 · TkA02G144230 · TK1151

Nucleus0.285

Rank 2 · TkA02G144230 · TK1151

Mitochondrion0.202

Rank 3 · TkA02G144230 · TK1151

Endoplasmic reticulum0.118

Rank 4 · TkA02G144230 · TK1151

Cell membrane0.086

Rank 5 · TkA02G144230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30847DUF874916-68 aa

PF12569NatA_aux_su32-92 aa

PF12569NatA_aux_su114-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G144230	`PF30847`	DUF8749	16	68	1.1e-12	48.9
TkA02G144230	`PF12569`	NatA_aux_su	32	92	9.9e-05	22.2
TkA02G144230	`PF12569`	NatA_aux_su	114	147	9.9e-05	22.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZM1`	Arabidopsis thaliana	sp\|Q8VZM1\|NAA15_ARATH N-terminal acetyltransferase A complex auxiliary subunit NAA15	70.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card