TkA02G142400 | RubberDandelionOmics

Gene overview

TkA02G142400

Reference: TK1151 Chr: Chr02 Coordinates: 36775193-36777193 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1006 bp · TkA02G142400|TK1151|cDNA

ATCACAAACATGTGGTTGTGTAGCGACACTCCTCCTCCATTCACCATTCTTTTATCCACTATCACCCTCTTTACATCTTCTCTCTTCATACTCATTCCCAATCGTACATTCCTCCCATGGCTGCCTTTACTCTCTCTCCTGCTACTTCCTCTCAGTTACGATCTGGTACCAATGGATTGTTCTCGCCGGCGCAAGGGCTGGTGGCGAAATCCGCCAAAAGCCAATCGGCCGGAAGGGAAAGAGGGATGAAGGTGACGTGT...

CDS

Download CDS FASTA

684 bp · TkA02G142400|TK1151|CDS

ATGGCTGCCTTTACTCTCTCTCCTGCTACTTCCTCTCAGTTACGATCTGGTACCAATGGATTGTTCTCGCCGGCGCAAGGGCTGGTGGCGAAATCCGCCAAAAGCCAATCGGCCGGAAGGGAAAGAGGGATGAAGGTGACGTGTCAGGCGGCCAGCATCCCCGCCGATCGAGTGCCGGATATGGAGAAGAGGAAGCTGATGAACTTGTTGCTTCTCGGTGCTATTGGTCTTCCATCCACCGGAATGTTGCTGCCGTACAC...

Protein

Download Protein FASTA

227 aa · TkA02G142400|TK1151|PROTEIN

MAAFTLSPATSSQLRSGTNGLFSPAQGLVAKSAKSQSAGRERGMKVTCQAASIPADRVPDMEKRKLMNLLLLGAIGLPSTGMLLPYTYFFVPPGSGGGSGGTPAKDALGNDIVVAEWLKTHGPGDRTLSQGLKGDPTYLVVENDKTLATYGINAVCTHLGCVVPWNKAENKFMCPCHGSQYNFQGKVVRGPAPLSLALAHADVDDGKVVFVPWTETDFRTGEAPWWS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G142400`
TK1151 ID	TkA02G142400
OH-1004 ID	LXL04_016433
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.100
Protein coverage (%)	TK1151 97.357 / OH-1004 97.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G142400

Location Chr02:36775193-36777193 (-)

Description Similar to petC: Cytochrome b6-f complex iron-sulfur subunit, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03280`	Essential protein for photoautotrophism.	Cytochrome b(6)f mutation specifically affects thermal dissipation of absorbed light energy in Arabidopsis.2001 · DOI: 10.1046/j.1365-313x.2001.01178.x Single point mutation in the Rieske iron-sulfur subunit of cytochrome b6/f leads to an altered pH dependence of plastoquinol oxidation in Arabidopsis.2002 · DOI: 10.1016/s0014-5793(02)02719-9 Knock-out of the genes coding for the Rieske protein and the ATP-synthase delta-subunit of Arabidopsis. Effects on photosynthesis, thylakoid protein composition, and nuclear chloroplast gene expression.2003 · DOI: 10.1104/pp.103.024190

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016433 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0009496 plastoquinol--plastocyanin reductase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

dosa:Os07g0556200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.941

Rank 1 · TkA02G142400 · TK1151

Mitochondrion0.054

Rank 2 · TkA02G142400 · TK1151

Extracellular0.009

Rank 3 · TkA02G142400 · TK1151

Cytoplasm0.009

Rank 4 · TkA02G142400 · TK1151

Nucleus0.008

Rank 5 · TkA02G142400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25471TM_PetC55-102 aa

PF00355Rieske134-194 aa

PF15920WHAMM-JMY_N158-180 aa

PF23641YmcF-like171-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G142400	`PF25471`	TM_PetC	55	102	1.1e-24	86.7
TkA02G142400	`PF00355`	Rieske	134	194	9.9e-10	38.9
TkA02G142400	`PF15920`	WHAMM-JMY_N	158	180	0.24	12.0
TkA02G142400	`PF23641`	YmcF-like	171	183	0.077	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZR03`	Arabidopsis thaliana	sp\|Q9ZR03\|UCRIA_ARATH Cytochrome b6-f complex iron-sulfur subunit, chloroplastic	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card