TkA02G135400 | RubberDandelionOmics

Gene overview

TkA02G135400

Reference: TK1151 Chr: Chr02 Coordinates: 34992476-34993610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

677 bp · TkA02G135400|TK1151|cDNA

GAATTGGCGTAAATTTGATAACGATACTTCAATAGGAGGCAAATCATTGACTGATACAAGTCGCTCCCAGTTCCAGTTTTTTTCATGTTCCGCAAAGTGCCCACTATGCTTAAAAAAATTGTGGAGCACATCAGAACACGAACATGATTATCCGATTTCCCAGATGGGTCTGTTCTTGCTGCTTCTTCGTTGGTCTATTTTTTGTTAATTTCATTCATGGAGAAGACATTCGAAGATCAGATTTCCCAGATGGGTTTCTG...

CDS

Download CDS FASTA

462 bp · TkA02G135400|TK1151|CDS

ATGATTATCCGATTTCCCAGATGGGTCTGTTCTTGCTGCTTCTTCGTTGGTCTATTTTTTGTTAATTTCATTCATGGAGAAGACATTCGAAGATCAGATTTCCCAGATGGGTTTCTGTTTGGAGTCGCTACTTCCTCCTACCAAATTGAAGGGGCACATCTTGAAGATGGTAAAAGTCTCAACAATTGGGATGTTTTCGCTCTTATCCCAGGCAACGTTGAAAATGGCGACAATGGGTTCATAGCTGATGATCATTACCA...

Protein

Download Protein FASTA

153 aa · TkA02G135400|TK1151|PROTEIN

MIIRFPRWVCSCCFFVGLFFVNFIHGEDIRRSDFPDGFLFGVATSSYQIEGAHLEDGKSLNNWDVFALIPGNVENGDNGFIADDHYHRYLEDINIIQSLGVDAYRFSISWARVLPRGRFGDVNPNGIMFYNKILDNLLLRVAENGFCIFRCIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G135400`
TK1151 ID	TkA02G135400
OH-1004 ID	LXL04_016475
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.100
Protein coverage (%)	TK1151 76.471 / OH-1004 22.286 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G135400

Location Chr02:34992476-34993610 (-)

Description Similar to BGLU18: Beta-glucosidase 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21760`	Beta-glucosidase 47.	No verified direct reference in this release
`At1g61820`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-galactoside and natural glucosides such as salicin, p-coumaryl alcohol glucoside, phenyl-beta-D-glucoside, coniferin, syringin and arbutin.	Arabidopsis thaliana beta-Glucosidases BGLU45 and BGLU46 hydrolyse monolignol glucosides.2006 · DOI: 10.1016/j.phytochem.2006.05.022

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0513900`	Hydrolyzes glycosides and monolignol glucosides.	No verified direct reference in this release
`Os04g0513400`	Hydrolyzes glycosides and monolignol glucosides.	No verified direct reference in this release
`Os04g0513100`	Probable inactive beta-glucosidase 14.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016475 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0016137 glycoside metabolic process Biological Process

GO:0033491 coniferin metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0047782 coniferin beta-glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G61810

ath:AT4G21760

dosa:Os04g0513100

dosa:Os04g0513400

dosa:Os04g0513900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.476

Rank 1 · TkA02G135400 · TK1151

Extracellular0.097

Rank 2 · TkA02G135400 · TK1151

Lysosome / Vacuole0.096

Rank 3 · TkA02G135400 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA02G135400 · TK1151

Mitochondrion0.053

Rank 5 · TkA02G135400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_132-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G135400	`PF00232`	Glyco_hydro_1	32	139	9.4e-43	147.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVS1`	Arabidopsis thaliana	sp\|Q9SVS1\|BGL47_ARATH Beta-glucosidase 47	52.500%	Swiss-Prot	High
`O80690`	Arabidopsis thaliana	sp\|O80690\|BGL46_ARATH Beta-glucosidase 46	55.100%	Swiss-Prot	High
`Q7XSK0`	Oryza sativa subsp. japonica	sp\|Q7XSK0\|BGL18_ORYSJ Beta-glucosidase 18	69.600%	Swiss-Prot	High
`Q7XSK2`	Oryza sativa subsp. japonica	sp\|Q7XSK2\|BGL16_ORYSJ Beta-glucosidase 16	62.800%	Swiss-Prot	High
`Q7XPY7`	Oryza sativa subsp. japonica	sp\|Q7XPY7\|BGL14_ORYSJ Probable inactive beta-glucosidase 14	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card