TkA02G133820 | RubberDandelionOmics

Gene overview

TkA02G133820

Reference: TK1151 Chr: Chr02 Coordinates: 34575009-34576429 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · TkA02G133820|TK1151|cDNA

ATGATCGACGTGAGGACGATGGTGAAAGAGAGGGAGAAGAAGAAGATGGTGGTGTCGCTGCTAATCCGTGGGATGATTCGGGGATCAACAACTGGTAGCATGGAAATCGGAAGATCTTCTTTTCGTGGTGAAGACACTCGTGATGGTTTTACAGATCATCTTTATACGGCCTTGAGTCAAGCAGGAATCCACACTTTTCGGGATGATACAATTGAAAGAGGAAAACTATTGATGCCAGAGCTAAAAAAGGCTATCCATGA...

CDS

Download CDS FASTA

501 bp · TkA02G133820|TK1151|CDS

ATGATCGACGTGAGGACGATGGTGAAAGAGAGGGAGAAGAAGAAGATGGTGGTGTCGCTGCTAATCCGTGGGATGATTCGGGGATCAACAACTGGTAGCATGGAAATCGGAAGATCTTCTTTTCGTGGTGAAGACACTCGTGATGGTTTTACAGATCATCTTTATACGGCCTTGAGTCAAGCAGGAATCCACACTTTTCGGGATGATACAATTGAAAGAGGAAAACTATTGATGCCAGAGCTAAAAAAGGCTATCCATGA...

Protein

Download Protein FASTA

166 aa · TkA02G133820|TK1151|PROTEIN

MIDVRTMVKEREKKKMVVSLLIRGMIRGSTTGSMEIGRSSFRGEDTRDGFTDHLYTALSQAGIHTFRDDTIERGKLLMPELKKAIHESAISLIVFSKSYSSSKWCLDEVMMIIEQHETSSSKHQFVPVFYKVVPSDVQNQTGSFRDSFDVYDDEINAETTLLRRKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G133820`
TK1151 ID	TkA02G133820
OH-1004 ID	LXL04_016495
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 99.398 / OH-1004 15.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G133820

Location Chr02:34575009-34576429 (+)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11170`	Putative disease resistance protein At4g11170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.508

Rank 1 · TkA02G133820 · TK1151

Nucleus0.270

Rank 2 · TkA02G133820 · TK1151

Cell membrane0.159

Rank 3 · TkA02G133820 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA02G133820 · TK1151

Mitochondrion0.110

Rank 5 · TkA02G133820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR40-151 aa

PF13676TIR_240-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G133820	`PF01582`	TIR	40	151	7.2e-32	111.3
TkA02G133820	`PF13676`	TIR_2	40	151	9.3e-14	52.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82500`	Arabidopsis thaliana	sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170	50.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card