TkA02G122490 | RubberDandelionOmics

Gene overview

TkA02G122490

Reference: TK1151 Chr: Chr02 Coordinates: 31783504-31784681 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

822 bp · TkA02G122490|TK1151|cDNA

ATGGTGGAAAGCACTTTGGTTTCATCTTGCCAGAAAAAGCTAGGTCCTATCACGGAGACATTGGGGAGGTTACGTAAACTAGAAGTTATCGAAGAAGACGCAATCCTTATTCCCAAAATCATGGCTATTGGCGATCGTTTGTCGGAAAAAACGAGTTTAATAGAGTCAAGCACGGGCCTAACTTTGCCCCGTAGATTAGACATGTGCACAAAGCTACCACTTGCTGTAAAACTTGAAGAAGACCCCTACGTAAAGATGAA...

CDS

Download CDS FASTA

822 bp · TkA02G122490|TK1151|CDS

ATGGTGGAAAGCACTTTGGTTTCATCTTGCCAGAAAAAGCTAGGTCCTATCACGGAGACATTGGGGAGGTTACGTAAACTAGAAGTTATCGAAGAAGACGCAATCCTTATTCCCAAAATCATGGCTATTGGCGATCGTTTGTCGGAAAAAACGAGTTTAATAGAGTCAAGCACGGGCCTAACTTTGCCCCGTAGATTAGACATGTGCACAAAGCTACCACTTGCTGTAAAACTTGAAGAAGACCCCTACGTAAAGATGAA...

Protein

Download Protein FASTA

273 aa · TkA02G122490|TK1151|PROTEIN

MVESTLVSSCQKKLGPITETLGRLRKLEVIEEDAILIPKIMAIGDRLSEKTSLIESSTGLTLPRRLDMCTKLPLAVKLEEDPYVKMKIELDYEGRSEAIQIESLTTGAIKKAILDIIGETNDIGTGMLTICVKKKGFMGLSIMDLPGLIRLASNRLINQEISSDKRIIILTVGSAQADFEAIESTMTAGLLTRRAKKCYRCWGFGAKDQRNLCDMVLENYQDLGRKTDENLKFAIDEDVMATFTYVVGRVKEILDNMLVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G122490`
TK1151 ID	TkA02G122490
OH-1004 ID	LXL04_016578
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G122490`
Location	Chr02:31783504-31784681 (-)
Description	Similar to DRP4C: Dynamin-related protein 4C
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016578` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009615 response to virus Biological Process GO:0031623 receptor internalization Biological Process GO:0035455 response to interferon-alpha Biological Process GO:0045087 innate immune response Biological Process GO:0046822 regulation of nucleocytoplasmic transport Biological Process GO:0051607 defense response to virus Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	ath:AT1G60500 ath:AT1G60530 cfa:403744 mcc:780935 pon:100174697 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.474

Rank 1 · TkA02G122490 · TK1151

Nucleus0.389

Rank 2 · TkA02G122490 · TK1151

Extracellular0.095

Rank 3 · TkA02G122490 · TK1151

Cell membrane0.060

Rank 4 · TkA02G122490 · TK1151

Mitochondrion0.057

Rank 5 · TkA02G122490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00350Dynamin_N40-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G122490	`PF00350`	Dynamin_N	40	185	1.3e-10	42.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card