TkA02G113440 | RubberDandelionOmics

Gene overview

TkA02G113440

Reference: TK1151 Chr: Chr02 Coordinates: 29669019-29671473 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1901 bp · TkA02G113440|TK1151|cDNA

AAATTTGGTCAAACGTCAAAAACTTTTAGTAGTTGAGGTTTTTCATTAACATTTACCCGAATGCCTGTTTGCTTTAGTGTAGAATCATCTATATTCCATGTGTATCTATGAACTTGTTCATCTGCTTATGCCTAATGTAGTAATTTCCTAAGGCGTCGGGATTCAGATACGGTACTAATAACCCCAGAGATCGAGAGCGTAGTTCCTACTTCTTAGAAACCGCGTAGCCATTCTAGTAGGGTAGACTGTTCCGGCAATGA...

CDS

Download CDS FASTA

558 bp · TkA02G113440|TK1151|CDS

ATGATGATCAACAAGTCACTTTTCTTGACTTACCTTTACTTATTGATCTACATTTTGCTTTCATTCTGGAGTTATTCTGTACAACAAGTGGGTTCTCTCTCCAAAGTACTTCAATTTTCCCTTTCTATCACTCTCACCATGATCCACATGGGCTTTTCAGGGAGCTGTAGCTTTCTTACTTGTACCCTTTTGCAGGTTGTTACTCCAGTTAAAATGACATTTGAAATATATGCAACATGTGTAGTTCCCATCAGTGCTTT...

Protein

Download Protein FASTA

185 aa · TkA02G113440|TK1151|PROTEIN

MMINKSLFLTYLYLLIYILLSFWSYSVQQVGSLSKVLQFSLSITLTMIHMGFSGSCSFLTCTLLQVVTPVKMTFEIYATCVVPISAFFASSLWFGNTAYLHISVAFIQMQKALMPVATLIMAVLCGTEKLWWDVLLNMLLVSVGVVISSYGEIHFNVIGTLYQVTGIFAEALRLVLTQVLLQKKG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G113440`
TK1151 ID	TkA02G113440
OH-1004 ID	LXL04_016663
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.800
Protein coverage (%)	TK1151 100.000 / OH-1004 52.557 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G113440

Location Chr02:29669019-29671473 (-)

Description Similar to At3g17430: Probable sugar phosphate/phosphate translocator At3g17430

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17430`	Probable sugar phosphate/phosphate translocator At3g17430.	No verified direct reference in this release
`At1g48230`	Probable sugar phosphate/phosphate translocator At1g48230.	No verified direct reference in this release
`At1g53660`	Probable sugar phosphate/phosphate translocator At1g53660.	No verified direct reference in this release
`At5g11230`	Probable sugar phosphate/phosphate translocator At5g11230.	No verified direct reference in this release
`At2g25520`	Probable sugar phosphate/phosphate translocator At2g25520.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G48230

ath:AT1G53660

ath:AT3G17430

ath:AT5G11230

ath:AT5G25400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.490

Rank 1 · TkA02G113440 · TK1151

Endoplasmic reticulum0.416

Rank 2 · TkA02G113440 · TK1151

Cytoplasm0.090

Rank 3 · TkA02G113440 · TK1151

Cell membrane0.040

Rank 4 · TkA02G113440 · TK1151

Nucleus0.039

Rank 5 · TkA02G113440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151TPT38-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G113440	`PF03151`	TPT	38	183	3.9e-08	33.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRP2`	Arabidopsis thaliana	sp\|Q9LRP2\|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430	75.500%	Swiss-Prot	High
`Q9LNH5`	Arabidopsis thaliana	sp\|Q9LNH5\|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230	73.900%	Swiss-Prot	High
`Q9C8M1`	Arabidopsis thaliana	sp\|Q9C8M1\|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660	45.800%	Swiss-Prot	Medium
`Q9LFN3`	Arabidopsis thaliana	sp\|Q9LFN3\|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230	45.300%	Swiss-Prot	Medium
`Q9SKJ7`	Arabidopsis thaliana	sp\|Q9SKJ7\|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520	43.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card