TkA02G112160 | RubberDandelionOmics

Gene overview

TkA02G112160

Reference: TK1151 Chr: Chr02 Coordinates: 29349399-29356767 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4386 bp · TkA02G112160|TK1151|cDNA

CGGCAAGTGAAGCAGGAAGAAGATCTGTTTTAGGCACCACATCTGATTAAATAATCAAAAGGGGCAGTTAAAAACCAGTCAATAAATCCAGTTCAAAATCACTAGTCAGTCTTCTTTGTTTGTATTATCTGTAAATTCCACTTGATGATTCCATAATCTCCCTTTCACTTTCTTTAATACAATTCCTCAAATCGAATGAAAAAAACCCGCATTCTAAATTCCATTCCCTTCTCGAATTTCGATCCGTAGATGCATTTCGC...

CDS

Download CDS FASTA

2166 bp · TkA02G112160|TK1151|CDS

ATGGGCGGAAAACAGGGTTCGATCATTGTTCATGTGGGCATTGTGTTGTTTACGATTTGGTTACTTTCTTCCTTCGATTACTGCCACCCACTGGCATACTTCCTTTCTTTCATCTATCTCTACCTGGTTCATGATCAGTATGCAATGAGATTGAGAAGAAAGATACAATTTGAGGAAAGAAAACAGGCAAATCAAAAGAGAGTACTTTCGGATTCTGAATCCGTAAGGTGGTTAAATCACACGATTGAAAGAATTTGGCC...

Protein

Download Protein FASTA

721 aa · TkA02G112160|TK1151|PROTEIN

MGGKQGSIIVHVGIVLFTIWLLSSFDYCHPLAYFLSFIYLYLVHDQYAMRLRRKIQFEERKQANQKRVLSDSESVRWLNHTIERIWPICMEEIVSQKILLPIIPWFLQKYKPWTVKEAVVQNIYLGRSPPMFTDMRVCRQSTGDDHLVLELGMNFRTAEDMNAILAVKLTKRLGFGMWAKMHLTGMHVEGKVLVGVKFLPNWPFIGRLRVCFVEPPYFQLTVKPIFAHGLDVTELPGIAGWLDKLLTLAFEETLVEPNML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G112160`
TK1151 ID	TkA02G112160
OH-1004 ID	LXL04_016680
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G112160

Location Chr02:29349399-29356767 (+)

Description Similar to NTMC2T6.1: C2 domain-containing protein At1g53590

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53590`	C2 domain-containing protein At1g53590.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016680 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006869 lipid transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0009409 response to cold Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009615 response to virus Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0046740 transport of virus in host, cell to cell Biological Process

GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G53590

ath:AT2G20990

ath:AT5G11100

mmu:272636

xtr:496831

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.457

Rank 1 · TkA02G112160 · TK1151

Endoplasmic reticulum0.185

Rank 2 · TkA02G112160 · TK1151

Cytoplasm0.179

Rank 3 · TkA02G112160 · TK1151

Golgi apparatus0.136

Rank 4 · TkA02G112160 · TK1151

Nucleus0.126

Rank 5 · TkA02G112160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20312DUF66089-43 aa

PF10296MMM171-181 aa

PF17047SMP_LBD71-264 aa

PF25669SMP_MUG190-like73-146 aa

PF25669SMP_MUG190-like187-268 aa

PF10296MMM1218-265 aa

PF00168C2289-369 aa

PF00168C2392-412 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G112160	`PF20312`	DUF6608	9	43	0.11	13.3
TkA02G112160	`PF10296`	MMM1	71	181	0.023	14.7
TkA02G112160	`PF17047`	SMP_LBD	71	264	0.03	14.5
TkA02G112160	`PF25669`	SMP_MUG190-like	73	146	1.7e-16	61.2
TkA02G112160	`PF25669`	SMP_MUG190-like	187	268	1.7e-16	61.2
TkA02G112160	`PF10296`	MMM1	218	265	0.023	14.7
TkA02G112160	`PF00168`	C2	289	369	4.7e-17	62.8
TkA02G112160	`PF00168`	C2	392	412	4.7e-17	62.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93XX4`	Arabidopsis thaliana	sp\|Q93XX4\|C2D61_ARATH C2 domain-containing protein At1g53590	56.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card