TkA02G111630 | RubberDandelionOmics

Gene overview

TkA02G111630

Reference: TK1151 Chr: Chr02 Coordinates: 29249283-29254114 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2901 bp · TkA02G111630|TK1151|cDNA

AAAAGAGCAAATGCATAGTAACAGAGGGAATTAAGATGAAATGAGAAGACAACGAACAGGGGAAATAAAGAAGGCCCCCCTCCAAACTTCAACTGCCCTGCCACAGGGATTCCTTGGAGTAGCATTTAAGACTATTTCTCTCTGGTTTTTCATCTTCTTCCCCACCAGCAGGTTCCATTGTTATAATTGCTTCAGAAAGGTGAAATCATATCTCGAATCATTTTGGTTTTTTGCAAGATTTGAGAGCAATATGGAGCATT...

CDS

Download CDS FASTA

2622 bp · TkA02G111630|TK1151|CDS

ATGAGAAGACAACGAACAGGGGAAATAAAGAAGGCCCCCCTCCAAACTTCAACTGCCCTGCCACAGGGATTCCTTGGAGTAGCATTTAAGACTATTTCTCTCTGGTTTTTCATCTTCTTCCCCACCAGCAGGTTCCATTGTTATAATTGCTTCAGAAAGGTGAAATCATATCTCGAATCATTTTGGTTTTTTGCAAGATTTGAGAGCAATATGGAGCATTGTGGCTGTAAAGTCGTCCCCATCGTCATCCTCTTCCTTGC...

Protein

Download Protein FASTA

873 aa · TkA02G111630|TK1151|PROTEIN

MRRQRTGEIKKAPLQTSTALPQGFLGVAFKTISLWFFIFFPTSRFHCYNCFRKVKSYLESFWFFARFESNMEHCGCKVVPIVILFLAAFIVCVVFNPPNLEVPPLTQQKLRALMGVKTLRKQHFGLPPSPSPSPSPSPSHSQPRARAPVHRVHLRPHRWPIALAPPDGGDGGRKRKVLVAVLASAGGATGIICVIGLFLGCRKLRKQRKRKSSSKNVKRVISDPVTDNFYLQSLGTVLDPPLVSSLKQDSDDNDRNFKSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G111630`
TK1151 ID	TkA02G111630
OH-1004 ID	LXL04_016685
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 97.824 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G111630

Location Chr02:29249283-29254114 (-)

Description Similar to FH11: Formin-like protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05470`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0431200`	Formin-like protein 9.	No verified direct reference in this release
`UniProt: A2YVG8`	Formin-like protein 9.	No verified direct reference in this release
`UniProt: A2XUA1`	Formin-like protein 2.	No verified direct reference in this release
`Os04g0461800`	Formin-like protein 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016685 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030036 actin cytoskeleton organization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0016020 membrane Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT3G05470

dosa:Os03g0204100

dosa:Os08g0431200

dosa:Os10g0347800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.668

Rank 1 · TkA02G111630 · TK1151

Nucleus0.199

Rank 2 · TkA02G111630 · TK1151

Cytoplasm0.195

Rank 3 · TkA02G111630 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA02G111630 · TK1151

Plastid0.033

Rank 5 · TkA02G111630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181FH2463-853 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G111630	`PF02181`	FH2	463	853	9.8e-103	344.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA60`	Arabidopsis thaliana	sp\|Q9MA60\|FH11_ARATH Formin-like protein 11	51.000%	Swiss-Prot	High
`Q6ZKB2`	Oryza sativa subsp. japonica	sp\|Q6ZKB2\|FH9_ORYSJ Formin-like protein 9	60.000%	Swiss-Prot	Low
`A2YVG8`	Oryza sativa subsp. indica	sp\|A2YVG8\|FH9_ORYSI Formin-like protein 9	60.000%	Swiss-Prot	Low
`A2XUA1`	Oryza sativa subsp. indica	sp\|A2XUA1\|FH2_ORYSI Formin-like protein 2	56.300%	Swiss-Prot	Low
`Q7XUV2`	Oryza sativa subsp. japonica	sp\|Q7XUV2\|FH2_ORYSJ Formin-like protein 2	56.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card