TkA02G109640 | RubberDandelionOmics

Gene overview

TkA02G109640

Reference: TK1151 Chr: Chr02 Coordinates: 28671327-28674798 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · TkA02G109640|TK1151|cDNA

GACATTTTAATATAATATATATGTACAACAACATATCAATTAGAGTATCATATATACAAGAAAGGAAATATATCTATATATAATGAAGAGGGCAGGTGGGATTGTTCTTCCATTTCATCAAGTCCATAAGTAAACTTTCTTCATTGCTCTTCTCGATCTGCTAGCTAGCTTCATCAATCATCATCGAAGATGGATAACCTGTATTTCTACGTGGGGATTATTGGCAACATCATCTCAGTTTTGATGTTTCTCTCCCCAAT...

CDS

Download CDS FASTA

732 bp · TkA02G109640|TK1151|CDS

ATGGATAACCTGTATTTCTACGTGGGGATTATTGGCAACATCATCTCAGTTTTGATGTTTCTCTCCCCAATGAAGACGTTCTGGAGAATAGTGAAGAAAGGATCAACAGAAGAGTTTAAGAGCCTTCCCTACATTTGCACTTTGCTTAATTCAAGTTTATGGACTTATTATGGAATCACGAAACCAGGAACTTATCTGGTCGCCACTGTTAATGGTTTTGGCATTCTTGTAGAGGTTATTTACCTTTCATTGTTCCTCAT...

Protein

Download Protein FASTA

243 aa · TkA02G109640|TK1151|PROTEIN

MDNLYFYVGIIGNIISVLMFLSPMKTFWRIVKKGSTEEFKSLPYICTLLNSSLWTYYGITKPGTYLVATVNGFGILVEVIYLSLFLIYAPPRTRGKTAMVAGLVDGVVFAVAVLVTQFWMEGEMRIDVIGLLGAGLNILMYASPLSAMRLVVTTKSVEYMPFLLSLFFFLNGGVWTLYAFLVKDWFLGVPNGTGFVLGFAQLAVYSVYKNSSKSAKVVSNGLEEGWQHESLLPSTTSNPINPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G109640`
TK1151 ID	TkA02G109640
OH-1004 ID	LXL04_029496
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.400
Protein coverage (%)	TK1151 95.062 / OH-1004 93.200 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G109640

Location Chr02:28671327-28674798 (+)

Description Similar to SWEET7: Bidirectional sugar transporter SWEET7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15920`	Acts as a vacuolar hexose transporter.	Leaf fructose content is controlled by the vacuolar transporter SWEET17 in Arabidopsis.2013 · DOI: 10.1016/j.cub.2013.03.021 SWEET17, a facilitative transporter, mediates fructose transport across the tonoplast of Arabidopsis roots and leaves.2014 · DOI: 10.1104/pp.113.232751
`At3g16690`	Mediates both low-affinity uptake and efflux of sugar across the vacuolar membrane.	Overexpression of the vacuolar sugar carrier AtSWEET16 modifies germination, growth, and stress tolerance in Arabidopsis.2013 · DOI: 10.1104/pp.113.224972 SWEET17, a facilitative transporter, mediates fructose transport across the tonoplast of Arabidopsis roots and leaves.2014 · DOI: 10.1104/pp.113.232751

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0341300`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os02g0513100`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2X5B4`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G10850

dosa:Os01g0605700

dosa:Os01g0606000

dosa:Os02g0301100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.623

Rank 1 · TkA02G109640 · TK1151

Lysosome / Vacuole0.159

Rank 2 · TkA02G109640 · TK1151

Cytoplasm0.107

Rank 3 · TkA02G109640 · TK1151

Endoplasmic reticulum0.100

Rank 4 · TkA02G109640 · TK1151

Golgi apparatus0.074

Rank 5 · TkA02G109640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv6-91 aa

PF03650MPC49-89 aa

PF04544Herpes_UL2076-171 aa

PF03083MtN3_slv128-212 aa

PF03650MPC154-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G109640	`PF03083`	MtN3_slv	6	91	7.6e-52	174.0
TkA02G109640	`PF03650`	MPC	49	89	0.016	16.1
TkA02G109640	`PF04544`	Herpes_UL20	76	171	0.23	12.6
TkA02G109640	`PF03083`	MtN3_slv	128	212	7.6e-52	174.0
TkA02G109640	`PF03650`	MPC	154	214	0.016	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WN3`	Arabidopsis thaliana	sp\|Q84WN3\|SWT17_ARATH Bidirectional sugar transporter SWEET17	60.000%	Swiss-Prot	High
`Q9LUR4`	Arabidopsis thaliana	sp\|Q9LUR4\|SWT16_ARATH Bidirectional sugar transporter SWEET16	53.800%	Swiss-Prot	High
`Q10LN5`	Oryza sativa subsp. japonica	sp\|Q10LN5\|SWT16_ORYSJ Bidirectional sugar transporter SWEET16	54.300%	Swiss-Prot	High
`Q6K602`	Oryza sativa subsp. japonica	sp\|Q6K602\|SWT15_ORYSJ Bidirectional sugar transporter SWEET15	46.000%	Swiss-Prot	Medium
`A2X5B4`	Oryza sativa subsp. indica	sp\|A2X5B4\|SWT15_ORYSI Bidirectional sugar transporter SWEET15	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card