TkA02G109180 | RubberDandelionOmics

Gene overview

TkA02G109180

Reference: TK1151 Chr: Chr02 Coordinates: 28535846-28538285 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA02G109180|TK1151|cDNA

TTCACTTTGGTTACAGCAAAGAGTGAAGACCCGAACCCGTTTCCTCCCTTTACGAACTCCAAAACCCTTCTTCAACCCTCTTCAATCAACTTCTCCTCCTTCTCCTTCTTCTCCTCCCCTCTGCAAAATATGAGTTCACTCGCTACGAAGCTCACAAGATCGTTACGCCTCTCTCTTTCTTCCCCATCCAGAGGTCCATTAGCACTAGGCGCGCAAGGAAGCTGGAAGAAGTTTTACTCATCATCATCTGCTAGTGGTGA...

CDS

Download CDS FASTA

774 bp · TkA02G109180|TK1151|CDS

TTCACTTTGGTTACAGCAAAGAGTGAAGACCCGAACCCGTTTCCTCCCTTTACGAACTCCAAAACCCTTCTTCAACCCTCTTCAATCAACTTCTCCTCCTTCTCCTTCTTCTCCTCCCCTCTGCAAAATATGAGTTCACTCGCTACGAAGCTCACAAGATCGTTACGCCTCTCTCTTTCTTCCCCATCCAGAGGTCCATTAGCACTAGGCGCGCAAGGAAGCTGGAAGAAGTTTTACTCATCATCATCTGCTAGTGGTGA...

Protein

Download Protein FASTA

257 aa · TkA02G109180|TK1151|PROTEIN

FTLVTAKSEDPNPFPPFTNSKTLLQPSSINFSSFSFFSSPLQNMSSLATKLTRSLRLSLSSPSRGPLALGAQGSWKKFYSSSSASGDEATDSIPADTVIDDDNFLPQKPELQMQGVDPRKGWGFRGVHKAIICGKVGQAPVQKILRNGRTVTIFTVGTGGMFDQRTIGPKDLPKPPQWHRIAVHNDSLGAYAVQQLTKNSSVYVEGDIETRVYNDSINGEVKNIPEICIRRDGKIRLVRSGESMSSISFDELREGLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G109180`
TK1151 ID	TkA02G109180
OH-1004 ID	LXL04_016713
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 84.436 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G109180

Location Chr02:28535846-28538285 (-)

Description Similar to At4g11060: Single-stranded DNA-binding protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11060`	Binds to ss-DNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016713 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0009432 SOS response Biological Process

GO:0090297 positive regulation of mitochondrial DNA replication Biological Process

GO:0090615 mitochondrial mRNA processing Biological Process

GO:0009295 nucleoid Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042645 mitochondrial nucleoid Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008047 enzyme activator activity Molecular Function

KEGG gene cross-reference

ath:AT4G11060

bab:bbp_488

ccr:CC_1468

rsp:RSP_1793

wbr:ssb

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.604

Rank 1 · TkA02G109180 · TK1151

Plastid0.322

Rank 2 · TkA02G109180 · TK1151

Nucleus0.081

Rank 3 · TkA02G109180 · TK1151

Cytoplasm0.037

Rank 4 · TkA02G109180 · TK1151

Cell membrane0.008

Rank 5 · TkA02G109180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00436SSB127-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G109180	`PF00436`	SSB	127	230	2e-19	70.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84J78`	Arabidopsis thaliana	sp\|Q84J78\|SSBP_ARATH Single-stranded DNA-binding protein, mitochondrial	64.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card