TkA02G105710 | RubberDandelionOmics

Gene overview

TkA02G105710

Reference: TK1151 Chr: Chr02 Coordinates: 27683163-27683666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA02G105710|TK1151|cDNA

ATGTTACAGAAACCACAGCCAACTTCAAGCCCCAGCAGCAGCAACTCACCTCCCGCCACCTTACGGAGAATAAAGCCGATCATTGATGACACGGTGAATCTGAACCGGGAGCTAGATCGTACAGAGCTAGAGTGCAAGATGTTCACTGACGAAATCCAAACTGCTGAAAAACTTGTCCTCAGATGTTCAAAAGTAAAGTGGGACATCATCAAGATGTTCCGTTACTCGCAGAAGCTAAATGATTTCCACAACAAGTTGTT...

CDS

Download CDS FASTA

504 bp · TkA02G105710|TK1151|CDS

ATGTTACAGAAACCACAGCCAACTTCAAGCCCCAGCAGCAGCAACTCACCTCCCGCCACCTTACGGAGAATAAAGCCGATCATTGATGACACGGTGAATCTGAACCGGGAGCTAGATCGTACAGAGCTAGAGTGCAAGATGTTCACTGACGAAATCCAAACTGCTGAAAAACTTGTCCTCAGATGTTCAAAAGTAAAGTGGGACATCATCAAGATGTTCCGTTACTCGCAGAAGCTAAATGATTTCCACAACAAGTTGTT...

Protein

Download Protein FASTA

167 aa · TkA02G105710|TK1151|PROTEIN

MLQKPQPTSSPSSSNSPPATLRRIKPIIDDTVNLNRELDRTELECKMFTDEIQTAEKLVLRCSKVKWDIIKMFRYSQKLNDFHNKLLRFFQIEVQAIQIRNCTQMLVMENNTNSKVDRMYADLSDMLQRTGAVSNHVGSESVDREKYGWHVPRPPVESWGLASHSRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G105710`
TK1151 ID	TkA02G105710
OH-1004 ID	LXL04_016754
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 82.036 / OH-1004 15.342 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G105710`
Location	Chr02:27683163-27683666 (-)
Description	Similar to At5g66900: Probable disease resistance protein At5g66900
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016754` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0009414 response to water deprivation Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0042742 defense response to bacterium Biological Process GO:0051707 response to other organism Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0012505 endomembrane system Cellular Component GO:0048046 apoplast Cellular Component GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT1G33560 ath:AT4G33300 ath:AT5G04720 ath:AT5G66900 ath:AT5G66910 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.357

Rank 1 · TkA02G105710 · TK1151

Cell membrane0.341

Rank 2 · TkA02G105710 · TK1151

Nucleus0.228

Rank 3 · TkA02G105710 · TK1151

Endoplasmic reticulum0.138

Rank 4 · TkA02G105710 · TK1151

Mitochondrion0.095

Rank 5 · TkA02G105710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17082Spc294-56 aa

PF05659RPW819-117 aa

PF17082Spc2988-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G105710	`PF17082`	Spc29	4	56	0.15	12.6
TkA02G105710	`PF05659`	RPW8	19	117	3.2e-21	76.1
TkA02G105710	`PF17082`	Spc29	88	135	0.15	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card