TkA02G105280 | RubberDandelionOmics

Gene overview

TkA02G105280

Reference: TK1151 Chr: Chr02 Coordinates: 27559362-27560601 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1024 bp · TkA02G105280|TK1151|cDNA

TTTGGAATCAAGTTTTGGGCGCAGAACATCAATGAGCGTATTTGGAGGAGACAGTTGGGGAAGAGAAGCACAGCACCGGAAGAGAAGAGTCGCCGATCTCCTGCTCGATGCAGCCGGCGATCATTCTTCCTACAGAAAACTTCCTAGCGGCAAATATGCATGCCTCGTGTGCCCTCATACTCCCGTCATCGATACCCCTCTCATGCTCTCTGTTCACGCTAAAGCAAGACGCCATGTTGATGCAGAATTGAGGCTCAAAC...

CDS

Download CDS FASTA

663 bp · TkA02G105280|TK1151|CDS

ATGAGCGTATTTGGAGGAGACAGTTGGGGAAGAGAAGCACAGCACCGGAAGAGAAGAGTCGCCGATCTCCTGCTCGATGCAGCCGGCGATCATTCTTCCTACAGAAAACTTCCTAGCGGCAAATATGCATGCCTCGTGTGCCCTCATACTCCCGTCATCGATACCCCTCTCATGCTCTCTGTTCACGCTAAAGCAAGACGCCATGTTGATGCAGAATTGAGGCTCAAACAAAGAGAAGAAGAACGGCAAAATGAGATGAA...

Protein

Download Protein FASTA

220 aa · TkA02G105280|TK1151|PROTEIN

MSVFGGDSWGREAQHRKRRVADLLLDAAGDHSSYRKLPSGKYACLVCPHTPVIDTPLMLSVHAKARRHVDAELRLKQREEERQNEMNKRMAISINSTSMSKFCNGDTSTKRINLASKPLIEKTQKDSFEVLHHGNSEKSSASNSQSRCSPTNDSTSIECNASGKDVVQLLLDYKEQREKELKFISAGWKRDCHGGWFRDENVIHVLCPCECIWYFSFFTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G105280`
TK1151 ID	TkA02G105280
OH-1004 ID	LXL04_017437
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 91.818 / OH-1004 84.167 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G105280`
Location	Chr02:27559362-27560601 (-)
Description	Similar to Scnm1: Sodium channel modifier 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017437` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000380 alternative mRNA splicing, via spliceosome Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0008380 RNA splicing Biological Process GO:0005634 nucleus Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005689 U12-type spliceosomal complex Cellular Component GO:0016607 nuclear speck Cellular Component GO:0071016 U12-type precatalytic spliceosome Cellular Component GO:0071018 U12-type catalytic step 2 spliceosome Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0019899 enzyme binding Molecular Function
KEGG gene cross-reference	bta:505644 dre:321696 hsa:100534012 hsa:79005 mmu:69269 xla:734762 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.760

Rank 1 · TkA02G105280 · TK1151

Cytoplasm0.270

Rank 2 · TkA02G105280 · TK1151

Mitochondrion0.039

Rank 3 · TkA02G105280 · TK1151

Cell membrane0.029

Rank 4 · TkA02G105280 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA02G105280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15803zf-SCNM144-69 aa

PF15805SCNM1_acidic63-77 aa

PF15805SCNM1_acidic177-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G105280	`PF15803`	zf-SCNM1	44	69	3.3e-10	40.1
TkA02G105280	`PF15805`	SCNM1_acidic	63	77	0.00073	19.9
TkA02G105280	`PF15805`	SCNM1_acidic	177	202	0.00073	19.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card