TkA02G103270 | RubberDandelionOmics

Gene overview

TkA02G103270

Reference: TK1151 Chr: Chr02 Coordinates: 27020514-27023775 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1814 bp · TkA02G103270|TK1151|cDNA

GGTTAGAAAGAGAGCAAGTTTTGGAGGGAGATTATATGACATCTACATACTTACAAGTTACAAGTTACAAGTACCAAAACGCTGCGTTTTGATCTTTGAAAATGGCAAAAAGAAAAGCGAAACCCGAATAACGCTAAGTGTGTGTTGTTGTGTATGGGTAGTGGTCGACAACCTCATTTCACTCCGACACGCACTGGTGTCACCGTCGAGGCGCATTCTCAGCAGTGATTTCCTAAATTTTCGTTGCTATTCATCATCTA...

CDS

Download CDS FASTA

882 bp · TkA02G103270|TK1151|CDS

ATGAAGAAGAAATTGACTCTGGAAGAAGGTTTGAATATACTGAATGAAGGTATAGCAAAGGCCATGATGATTCTGGATGGGTACCCCACCAGTACATTATTCACTTGTGAAGAATACATGAAGCTCTATGACTGTGTGTATGATATGTGTGTTCAACATCCTCCTTATGAGTACTGTTCAGAGCTCTATGACATATTCCAGAAAGCTTTGGAACAGGGCATTACTTCAAGAGTCATACCAGCTGTGAAAGACAAATCACA...

Protein

Download Protein FASTA

293 aa · TkA02G103270|TK1151|PROTEIN

MKKKLTLEEGLNILNEGIAKAMMILDGYPTSTLFTCEEYMKLYDCVYDMCVQHPPYEYCSELYDIFQKALEQGITSRVIPAVKDKSHIILLYELWHMWSKYKIMAKCLGGFFLYLDRHFVEDRKSASLSDLSISCFHDLVCVELYPKLLEAAICLIHEDRDHNSVCKDLLKNVSTFFVEIGRGSMRYYENFEGAVLSNTETYYNYLVPQWLQHYSSADYVLKAEFCLNQEKERTSEFLHQTSVEKLLRLVHGLLLGQTAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G103270`
TK1151 ID	TkA02G103270
OH-1004 ID	LXL04_016783
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.752 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G103270`
Location	Chr02:27020514-27023775 (+)
Description	Similar to CUL1: Cullin-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016783` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010265 SCF complex assembly Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
KEGG gene cross-reference	ath:AT1G02980 ath:AT1G43140 ath:AT1G59790 ath:AT4G02570 dosa:Os01g0369000 osa:4325735 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.736

Rank 1 · TkA02G103270 · TK1151

Nucleus0.275

Rank 2 · TkA02G103270 · TK1151

Cell membrane0.106

Rank 3 · TkA02G103270 · TK1151

Golgi apparatus0.088

Rank 4 · TkA02G103270 · TK1151

Mitochondrion0.063

Rank 5 · TkA02G103270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06920DHR-2_Lobe_A27-72 aa

PF00888Cullin35-266 aa

PF06920DHR-2_Lobe_A148-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G103270	`PF06920`	DHR-2_Lobe_A	27	72	0.023	15.8
TkA02G103270	`PF00888`	Cullin	35	266	1.5e-41	144.0
TkA02G103270	`PF06920`	DHR-2_Lobe_A	148	157	0.023	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card