TkA02G102610 | RubberDandelionOmics

Gene overview

TkA02G102610

Reference: TK1151 Chr: Chr02 Coordinates: 26857837-26858190 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA02G102610|TK1151|cDNA

ATGGTGGAAGAGCAAGATAAATTGCTACCCGTCGCAAATGTGGGCCGGATAATGAAAAAGATCCTACCACCCACCGCCAAGATCTCCAAAGAAGCCAAAGAAACCATACAAGAATGTGCATCGGAGTTCATAAGTTTCGTCACCGGTGAAGCATCCGACAAGTGCCATAAGGAGAACCGCAAGACTGTTAATGGCGACGACATCTGTTGGGCTCTTGGGTCGCTAGGGTTTGATGACTATTCTCAGGCCATTGCTCGCTA...

CDS

Download CDS FASTA

354 bp · TkA02G102610|TK1151|CDS

ATGGTGGAAGAGCAAGATAAATTGCTACCCGTCGCAAATGTGGGCCGGATAATGAAAAAGATCCTACCACCCACCGCCAAGATCTCCAAAGAAGCCAAAGAAACCATACAAGAATGTGCATCGGAGTTCATAAGTTTCGTCACCGGTGAAGCATCCGACAAGTGCCATAAGGAGAACCGCAAGACTGTTAATGGCGACGACATCTGTTGGGCTCTTGGGTCGCTAGGGTTTGATGACTATTCTCAGGCCATTGCTCGCTA...

Protein

Download Protein FASTA

117 aa · TkA02G102610|TK1151|PROTEIN

MVEEQDKLLPVANVGRIMKKILPPTAKISKEAKETIQECASEFISFVTGEASDKCHKENRKTVNGDDICWALGSLGFDDYSQAIARYLHKHREFERVRASTAAASSSAALELEASDC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G102610`
TK1151 ID	TkA02G102610
OH-1004 ID	LXL04_016788
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G102610

Location Chr02:26857837-26858190 (-)

Description Similar to NFYB5: Nuclear transcription factor Y subunit B-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47810`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`At1g09030`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`At4g14540`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0413000`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`Os07g0606600`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016788 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

KEGG gene cross-reference

ath:AT1G09030

ath:AT2G47810

ath:AT4G14540

ath:AT5G47640

dosa:Os03g0413000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA02G102610 · TK1151

Cytoplasm0.188

Rank 2 · TkA02G102610 · TK1151

Mitochondrion0.019

Rank 3 · TkA02G102610 · TK1151

Cell membrane0.013

Rank 4 · TkA02G102610 · TK1151

Golgi apparatus0.006

Rank 5 · TkA02G102610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125Histone3-71 aa

PF15511CENP-T_C4-69 aa

PF00808CBFD_NFYB_HMF9-72 aa

PF13274SocA_Panacea13-59 aa

PF07524Bromo_TP29-78 aa

PF00125Histone93-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G102610	`PF00125`	Histone	3	71	1.3e-05	26.2
TkA02G102610	`PF15511`	CENP-T_C	4	69	0.004	18.0
TkA02G102610	`PF00808`	CBFD_NFYB_HMF	9	72	9.4e-27	93.8
TkA02G102610	`PF13274`	SocA_Panacea	13	59	0.13	14.0
TkA02G102610	`PF07524`	Bromo_TP	29	78	0.0015	19.2
TkA02G102610	`PF00125`	Histone	93	101	1.3e-05	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82248`	Arabidopsis thaliana	sp\|O82248\|NFYB5_ARATH Nuclear transcription factor Y subunit B-5	75.800%	Swiss-Prot	High
`O04027`	Arabidopsis thaliana	sp\|O04027\|NFYB4_ARATH Nuclear transcription factor Y subunit B-4	71.600%	Swiss-Prot	High
`O23310`	Arabidopsis thaliana	sp\|O23310\|NFYB3_ARATH Nuclear transcription factor Y subunit B-3	64.600%	Swiss-Prot	High
`Q75IZ7`	Oryza sativa subsp. japonica	sp\|Q75IZ7\|NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8	67.700%	Swiss-Prot	High
`Q69J40`	Oryza sativa subsp. japonica	sp\|Q69J40\|NFYBA_ORYSJ Nuclear transcription factor Y subunit B-10	64.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card