TkA02G099830 | RubberDandelionOmics

Gene overview

TkA02G099830

Reference: TK1151 Chr: Chr02 Coordinates: 26045164-26046144 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · TkA02G099830|TK1151|cDNA

ATGGGTTCAGAGGCCAAATTGGTCGAGAAAGTGTGTGAAATCTATGACAAAATCTCTAAACTTGAAACCCTCAAACCTTCCAAAGATGTCAACACTCTCTTCACCGAGCTTGTACTCACATGCATTCCACCATCTTCCATCACCATATCCACTCTTCCAGAAAACATTCAAGAAACAAGGTCTAGGCTCATTAGACTTTGTGGTGAAGCCGAAGGCCATTTAGAGGCCCATTTCTCCACTCTTTTAGCCTCTTTTCCTAA...

CDS

Download CDS FASTA

981 bp · TkA02G099830|TK1151|CDS

ATGGGTTCAGAGGCCAAATTGGTCGAGAAAGTGTGTGAAATCTATGACAAAATCTCTAAACTTGAAACCCTCAAACCTTCCAAAGATGTCAACACTCTCTTCACCGAGCTTGTACTCACATGCATTCCACCATCTTCCATCACCATATCCACTCTTCCAGAAAACATTCAAGAAACAAGGTCTAGGCTCATTAGACTTTGTGGTGAAGCCGAAGGCCATTTAGAGGCCCATTTCTCCACTCTTTTAGCCTCTTTTCCTAA...

Protein

Download Protein FASTA

326 aa · TkA02G099830|TK1151|PROTEIN

MGSEAKLVEKVCEIYDKISKLETLKPSKDVNTLFTELVLTCIPPSSITISTLPENIQETRSRLIRLCGEAEGHLEAHFSTLLASFPNPIHHLEVFPYYSNYIKLSHLEFDILTRHYSTEPGVTPQSIAFVGSGPLPLTSIVLASNHLKNTYFHNYDIDHEANSMAARLVSQDPDLSRRMFFHSTDIMEVTDELKDYDVIFLAALVGMDISEKVKVIEHLAKFMAPGGILMLRSAHGARAFLYPVVEPEDLQGFEVLSIFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G099830`
TK1151 ID	TkA02G099830
OH-1004 ID	LXL04_016829
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G099830

Location Chr02:26045164-26046144 (-)

Description Similar to CHLN: Nicotianamine synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56430`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At1g09240`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At5g04950`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At5g56080`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016829 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010233 phloem transport Biological Process

GO:0030418 nicotianamine biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0030410 nicotianamine synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09240

ath:AT1G56430

ath:AT5G04950

dosa:Os07g0689600

sly:101248619

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.651

Rank 1 · TkA02G099830 · TK1151

Nucleus0.357

Rank 2 · TkA02G099830 · TK1151

Mitochondrion0.069

Rank 3 · TkA02G099830 · TK1151

Cell membrane0.064

Rank 4 · TkA02G099830 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA02G099830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03059NAS4-276 aa

PF08242Methyltransf_12131-229 aa

PF13578Methyltransf_24141-230 aa

PF13649Methyltransf_25143-227 aa

PF13489Methyltransf_23153-233 aa

PF01739CheR159-231 aa

PF13847Methyltransf_31169-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G099830	`PF03059`	NAS	4	276	5.5e-125	417.0
TkA02G099830	`PF08242`	Methyltransf_12	131	229	0.00071	21.0
TkA02G099830	`PF13578`	Methyltransf_24	141	230	0.054	15.1
TkA02G099830	`PF13649`	Methyltransf_25	143	227	0.007	17.7
TkA02G099830	`PF13489`	Methyltransf_23	153	233	0.24	11.8
TkA02G099830	`PF01739`	CheR	159	231	0.0094	16.1
TkA02G099830	`PF13847`	Methyltransf_31	169	235	0.0042	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7X5`	Arabidopsis thaliana	sp\|Q9C7X5\|NAS4_ARATH Probable nicotianamine synthase 4	67.000%	Swiss-Prot	High
`O80483`	Arabidopsis thaliana	sp\|O80483\|NAS3_ARATH Nicotianamine synthase 3	57.900%	Swiss-Prot	High
`Q9FF79`	Arabidopsis thaliana	sp\|Q9FF79\|NAS1_ARATH Nicotianamine synthase 1	59.900%	Swiss-Prot	High
`Q9FKT9`	Arabidopsis thaliana	sp\|Q9FKT9\|NAS2_ARATH Nicotianamine synthase 2	52.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card