TkA02G099630 | RubberDandelionOmics

Gene overview

TkA02G099630

Reference: TK1151 Chr: Chr02 Coordinates: 25982882-25988692 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3264 bp · TkA02G099630|TK1151|cDNA

CTGAATTGTTCGAGTCGGCTCAAACGGAACCAACTTTTTCAACGCAATGAAACACTCCATCAGTCTCCATTTCTAGATTCAGGGAGAAAACCACGCCTCTTCGTCCTACGAAAATTTAGGCGTTTGAGATAAACTGAAATAAAAACAACAAAATTCGAAAAAAGATGACGTGGTTTAGGGCTGGATCTAGCATCGCAAAGCTAGCGATCAAAAGAAGCATATCACAAACCGGAACATACGCAAGAAGAAAACAAACCCTT...

CDS

Download CDS FASTA

3081 bp · TkA02G099630|TK1151|CDS

ATGACGTGGTTTAGGGCTGGATCTAGCATCGCAAAGCTAGCGATCAAAAGAAGCATATCACAAACCGGAACATACGCAAGAAGAAAACAAACCCTTCTTCTCCCATCACAAACCCGCCAATTTCACACCTCCCTTTTCAAATCAAAATCCGCCCAGTCAGCACCGGTCCCACGCGCGGTCCCCTTATCCCGCCTAACCGACAGTTTCCTAGACGGGACCAGCAGTGTCTACCTGGAAGAGCTCCAAAGAGCCTGGGAAAA...

Protein

Download Protein FASTA

1026 aa · TkA02G099630|TK1151|PROTEIN

MTWFRAGSSIAKLAIKRSISQTGTYARRKQTLLLPSQTRQFHTSLFKSKSAQSAPVPRAVPLSRLTDSFLDGTSSVYLEELQRAWENDPQSVDESWDNFFRNFVGQASTSPGISGQTIQESMRLLLLVRAYQVYGHMKAKIDPLGLETREIPDDLDPAFYGFTESDLDREFFLGVWRMSGFLSENRPVQTLRSILTRLDQAYSGPIGYEYMHIADRERCNWLRDRIETPTPTQYNSERREVILDRLIWSTQFENFLATKW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G099630`
TK1151 ID	TkA02G099630
OH-1004 ID	LXL04_016831
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G099630`
Location	Chr02:25982882-25988692 (-)
Description	Similar to ogdh: 2-oxoglutarate dehydrogenase, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016831` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006091 generation of precursor metabolites and energy Biological Process GO:0006096 glycolytic process Biological Process GO:0006099 tricarboxylic acid cycle Biological Process GO:0006103 2-oxoglutarate metabolic process Biological Process GO:0006104 succinyl-CoA metabolic process Biological Process GO:0045333 cellular respiration Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0042645 mitochondrial nucleoid Cellular Component GO:0045252 oxoglutarate dehydrogenase complex Cellular Component
KEGG gene cross-reference	ddi:DDB_G0288127 sce:YIL125W spo:2540991 vda:VDAG_10018 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.906

Rank 1 · TkA02G099630 · TK1151

Cytoplasm0.085

Rank 2 · TkA02G099630 · TK1151

Nucleus0.060

Rank 3 · TkA02G099630 · TK1151

Plastid0.019

Rank 4 · TkA02G099630 · TK1151

Cell membrane0.017

Rank 5 · TkA02G099630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF160782-oxogl_dehyd_N67-104 aa

PF00676E1_dh248-568 aa

PF160782-oxogl_dehyd_N483-490 aa

PF02779Transket_pyr638-851 aa

PF16870OxoGdeHyase_C874-1015 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G099630	`PF16078`	2-oxogl_dehyd_N	67	104	5.5e-15	55.4
TkA02G099630	`PF00676`	E1_dh	248	568	4.8e-60	203.8
TkA02G099630	`PF16078`	2-oxogl_dehyd_N	483	490	5.5e-15	55.4
TkA02G099630	`PF02779`	Transket_pyr	638	851	8.2e-48	163.1
TkA02G099630	`PF16870`	OxoGdeHyase_C	874	1015	1.8e-50	171.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card