RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G097720
Reference: TK1151 Chr: Chr02 Coordinates: 25563623-25566793 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2423 bp · TkA02G097720|TK1151|cDNA

TATGATTTGTTTGTTTAAAACTAAAAACTAAAAGTACTCAAATCTAACAACCAAACACACCCTATCTGTATTATTTGTTTTCTTTTTCTAATTCAAATGCAGAAGTTGAAACATTGAAAACTTGAGGGGATATATTCGTAAAACCACATTGTATATATACTGCTTTGACGAGCAAAAAGTCAACTAATTAGCGCAGAGCCGCAGACGTTATCCACTGCTGGCCACCGTGAATTCTCGACGGAGAAACTGAGAAACATGAA...

CDS

Download CDS FASTA

1770 bp · TkA02G097720|TK1151|CDS

ATGAACATGTACACGAAGCAAAAGCGGCCAGGCCGGAGACTTGAGCGGAAAAATGCATTCAAAAATGCGGATTATGACGCTTCTACATCGACATCATCATCTTCTTCATCTTCGCCGTTGTTTGATATTCAATCAGCTCATCGAACACAATCACTGGATATCAATTTGTTATCAGATCGAATAAGTCACCGAGTTGAAGGAAATGACGGAGAGGTCGACCTGATTTGCCGGTCTCTAGGGCTGTCTGGACCAGAAGATTT...

Protein

Download Protein FASTA

589 aa · TkA02G097720|TK1151|PROTEIN

MNMYTKQKRPGRRLERKNAFKNADYDASTSTSSSSSSSPLFDIQSAHRTQSLDINLLSDRISHRVEGNDGEVDLICRSLGLSGPEDFAIPAADWEAHKACSPTGSNYFVGSRFGCFTPDSTKQSPRSDFSEGFESPDRADDYEVKRDTQCLRLAKSEEARVLLDYGGRKRGDDVIGIGISEIKRVNEYSQLMTSDEDTCKSRGRGDAEGKMRLKGVRPPSLARPPAMPRVIVDNPGSVRRFTPIRSSLTQDTAAIVKPPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G097720
TK1151 IDTkA02G097720
OH-1004 IDLXL04_016850
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.700
Protein coverage (%)TK1151 100.000 / OH-1004 96.110
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G097720
LocationChr02:25563623-25566793 (-)
DescriptionSimilar to MEKK1: Mitogen-activated protein kinase kinase kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g08500 The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.
MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a
The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023
Phosphorylation of Arabidopsis thaliana MEKK1 via Ca(2+) signaling as a part of the cold stress response.2013 · DOI: 10.1007/s10265-013-0576-0
At4g08480 Triggers SUMM2-mediated immune responses, including cell death and defense responses.
The MEKK1-MKK1/MKK2-MPK4 kinase cascade negatively regulates immunity mediated by a mitogen-activated protein kinase kinase kinase in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097253
Glutamate signalling via a MEKK1 kinase-dependent pathway induces changes in Arabidopsis root architecture.2013 · DOI: 10.1111/tpj.12201
Deletion of a tandem gene family in Arabidopsis: increased MEKK2 abundance triggers autoimmunity when the MEKK1-MKK1/2-MPK4 signaling cascade is disrupted.2013 · DOI: 10.1105/tpc.113.112102
At4g08470 Mitogen-activated protein kinase kinase kinase 3. No verified direct reference in this release
At4g12020 Transcription factor. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_016850 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000165 MAPK cascade Biological Process
GO:0006952 defense response Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009409 response to cold Biological Process
GO:0009611 response to wounding Biological Process
GO:0009631 cold acclimation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010200 response to chitin Biological Process
GO:0010449 root meristem growth Biological Process
GO:0022622 root system development Biological Process
GO:0031347 regulation of defense response Biological Process
GO:0045087 innate immune response Biological Process
KEGG gene cross-reference
ath:AT4G08470
ath:AT4G08480
ath:AT4G08500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.550
Rank 1 · TkA02G097720 · TK1151
Nucleus0.345
Rank 2 · TkA02G097720 · TK1151
Cell membrane0.228
Rank 3 · TkA02G097720 · TK1151
Golgi apparatus0.046
Rank 4 · TkA02G097720 · TK1151
Endoplasmic reticulum0.046
Rank 5 · TkA02G097720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase316-569 aa
PF07714PK_Tyr_Ser-Thr319-564 aa
PF10707YrbL-PhoP_reg355-449 aa
PF06293Kdo397-453 aa
PF14531Kinase-like417-516 aa
PF17667Pkinase_fungal423-485 aa
PF03109ABC1427-467 aa
PF12330Haspin_kinase435-464 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G097720PF00069Pkinase3165694.6e-69233.4
TkA02G097720PF07714PK_Tyr_Ser-Thr3195645.1e-48164.3
TkA02G097720PF10707YrbL-PhoP_reg3554490.007816.6
TkA02G097720PF06293Kdo3974530.2911.2
TkA02G097720PF14531Kinase-like4175163.9e-0627.1
TkA02G097720PF17667Pkinase_fungal4234850.01714.5
TkA02G097720PF03109ABC14274670.02114.7
TkA02G097720PF12330Haspin_kinase4354640.1112.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q39008Arabidopsis thalianasp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 146.000%Swiss-ProtMedium
O81472Arabidopsis thalianasp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 952.300%Swiss-ProtMedium
Q9M0T3Arabidopsis thalianasp|Q9M0T3|MP3K3_ARATH Mitogen-activated protein kinase kinase kinase 365.300%Swiss-ProtLow
Q9SZ67Arabidopsis thalianasp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 1951.200%Swiss-ProtMedium

JBrowse

View in Genome Browser