TkA02G094240 | RubberDandelionOmics

Gene overview

TkA02G094240

Reference: TK1151 Chr: Chr02 Coordinates: 24578732-24579775 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

983 bp · TkA02G094240|TK1151|cDNA

TTACATCAAAGACATCTACAATCCCAATTTCTTTGTTTCTAAACGAAATCTCATCAAATTTCTTCGTTCTCAACCCAAATCTCTCCAAATTCCGTTGTTTTTGAACGAATCCACCAAATCTCAGACGCGATCTAACTCAAAAAACCCATCGTCTCCAATAAACAAAAAACAGAGTAAATATCCATGGTACACATTTGTTATTCCCATCTCCTTCTCCAATCACCATCACATCAAATTCATCAAAACCCACCACCAAACTC...

CDS

Download CDS FASTA

378 bp · TkA02G094240|TK1151|CDS

ATGGCGGATATGCCGGAAGGAACGATGCGAAATGTACTGGAACAGAAAACTCTCAAGTGGGTATTCGTTGGTGGAAAGGGCGGTGTCGGAAAAACTACGTGTAGCTCTATCCTCTCAATTCTTTTGGCATCAGCGAGATCCTCTGTTCTTATAATTTCAACTGACCCAGCTCACAATCTCAGCGATGCGTTTCAACAGAGGTTCACGAAAGCTCCTACTTTGGTTAATGGGTTCACCAATTTGTATGCTATGGAGGTGGA...

Protein

Download Protein FASTA

125 aa · TkA02G094240|TK1151|PROTEIN

MADMPEGTMRNVLEQKTLKWVFVGGKGGVGKTTCSSILSILLASARSSVLIISTDPAHNLSDAFQQRFTKAPTLVNGFTNLYAMEVDPNVENEEEGSDGMDGFLSDLANSIPGIDEAMSFAEMLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G094240`
TK1151 ID	TkA02G094240
OH-1004 ID	LXL04_026777
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 35.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G094240

Location Chr02:24578732-24579775 (-)

Description Similar to GET3A: ATPase GET3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01910`	ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum.	Loss of GET pathway orthologs in Arabidopsis thaliana causes root hair growth defects and affects SNARE abundance.2017 · DOI: 10.1073/pnas.1619525114

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026777 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048767 root hair elongation Biological Process

GO:0071816 tail-anchored membrane protein insertion into ER membrane Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043529 GET complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

aag:5574421

ath:AT1G01910

cnb:CNBK0900

cne:CNK02640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579

Rank 1 · TkA02G094240 · TK1151

Nucleus0.439

Rank 2 · TkA02G094240 · TK1151

Endoplasmic reticulum0.075

Rank 3 · TkA02G094240 · TK1151

Lysosome / Vacuole0.059

Rank 4 · TkA02G094240 · TK1151

Peroxisome0.059

Rank 5 · TkA02G094240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931NB-ARC11-35 aa

PF25199nSTAND_NTPase511-61 aa

PF06414Zeta_toxin12-55 aa

PF07755DUF161114-69 aa

PF20720nSTAND315-55 aa

PF02374ArsA_ATPase19-125 aa

PF13191AAA_1619-64 aa

PF01656CbiA21-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G094240	`PF00931`	NB-ARC	11	35	0.012	15.9
TkA02G094240	`PF25199`	nSTAND_NTPase5	11	61	0.031	14.8
TkA02G094240	`PF06414`	Zeta_toxin	12	55	0.0028	17.8
TkA02G094240	`PF07755`	DUF1611	14	69	0.0038	17.4
TkA02G094240	`PF20720`	nSTAND3	15	55	0.055	13.9
TkA02G094240	`PF02374`	ArsA_ATPase	19	125	2.9e-36	126.0
TkA02G094240	`PF13191`	AAA_16	19	64	0.22	12.8
TkA02G094240	`PF01656`	CbiA	21	107	3.8e-09	37.3
TkA02G094240	`PF13238`	AAA_18	21	66	0.029	15.6
TkA02G094240	`PF00448`	SRP54	21	55	0.034	14.5
TkA02G094240	`PF13479`	AAA_24	21	60	0.22	11.9
TkA02G094240	`PF03308`	MeaB	21	60	0.22	11.2
TkA02G094240	`PF00142`	Fer4_NifH	22	64	0.00033	21.0
TkA02G094240	`PF10609`	ParA	22	55	0.00046	20.4
TkA02G094240	`PF06564`	CBP_BcsQ	23	70	0.029	14.6
TkA02G094240	`PF03029`	ATP_bind_1	24	58	0.25	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949M9`	Arabidopsis thaliana	sp\|Q949M9\|GET3A_ARATH ATPase GET3A	80.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card