TkA02G092110 | RubberDandelionOmics

Gene overview

TkA02G092110

Reference: TK1151 Chr: Chr02 Coordinates: 23996311-23998112 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1435 bp · TkA02G092110|TK1151|cDNA

GCGGGGGCATGGCGGGACCCGAAGGATTCAATACGTGTCAATGGAGTCGAGAGAAGGCCACAACTTAATCAAAATCGAAACGATCCGTTCAATTTATGATTTTTTTTCTCTCTGTAATTGCCGTCTCTTTTCCTCAAAATATCTTCCCAACAACCTCAGCTTCGTCTCTCAGCTTTTGATTTTTCTTCACCTGCAATTCCGTTCAAATTTTTCACAACCAAAACAGATGATCAGAAACTCCAATTTTCAGGCCAGGAAGA...

CDS

Download CDS FASTA

1140 bp · TkA02G092110|TK1151|CDS

ATGGAGTCGAGAGAAGGCCACAACTTAATCAAAATCGAAACGATCCGTTCAATTTATGATTTTTTTTCTCTCTGTAATTGCCGTCTCTTTTCCTCAAAATATCTTCCCAACAACCTCAGCTTCGTCTCTCAGCTTTTGATTTTTCTTCACCTGCAATTCCGTTCAAATTTTTCACAACCAAAACAGATGATCAGAAACTCCAATTTTCAGGCCAGGAAGAGGAAGTGGAAGCCGGTTTTGTTTCTTCTCAGGAAGAGGAA...

Protein

Download Protein FASTA

379 aa · TkA02G092110|TK1151|PROTEIN

MESREGHNLIKIETIRSIYDFFSLCNCRLFSSKYLPNNLSFVSQLLIFLHLQFRSNFSQPKQMIRNSNFQARKRKWKPVLFLLRKRKRKDDEEPHHDVNIVQVFEGNKGNEIDDDSRRHTDTDHGGSDGFDADERDENPFDENPFDEKIEGFENENPSFDHDLKTKETKEEEEETSKSALLIVSERKKYGGAAPPDDDCCPICFEDFSIACKTNCGHWFCASCILQFWTYKTALQKCNCPICARPITELTPEASLSFIRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G092110`
TK1151 ID	TkA02G092110
OH-1004 ID	LXL04_031821
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.700
Protein coverage (%)	TK1151 45.119 / OH-1004 92.473 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G092110`
Location	Chr02:23996311-23998112 (+)
Description	Similar to RNF170: E3 ubiquitin-protein ligase RNF170
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031821` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0009266 response to temperature stimulus Biological Process GO:0010467 gene expression Biological Process GO:0010498 proteasomal protein catabolic process Biological Process GO:0014823 response to activity Biological Process GO:0016567 protein ubiquitination Biological Process GO:0030163 protein catabolic process Biological Process GO:0034138 toll-like receptor 3 signaling pathway Biological Process GO:0034140 negative regulation of toll-like receptor 3 signaling pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045087 innate immune response Biological Process GO:0070936 protein K48-linked ubiquitination Biological Process
KEGG gene cross-reference	dre:406612 hsa:81790 mmu:77733 xtr:549626 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.351

Rank 1 · TkA02G092110 · TK1151

Cell membrane0.246

Rank 2 · TkA02G092110 · TK1151

Nucleus0.208

Rank 3 · TkA02G092110 · TK1151

Cytoplasm0.182

Rank 4 · TkA02G092110 · TK1151

Golgi apparatus0.155

Rank 5 · TkA02G092110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920zf-C3HC4_3197-248 aa

PF04423Rad50_zn_hook197-207 aa

PF24921RING_XB3-XBAT31199-247 aa

PF13639zf-RING_2199-242 aa

PF13445zf-RING_UBOX200-240 aa

PF00097zf-C3HC4200-242 aa

PF13923zf-C3HC4_2200-242 aa

PF15227zf-C3HC4_4200-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G092110	`PF13920`	zf-C3HC4_3	197	248	1.6e-05	25.3
TkA02G092110	`PF04423`	Rad50_zn_hook	197	207	5.3	7.6
TkA02G092110	`PF24921`	RING_XB3-XBAT31	199	247	2e-05	25.2
TkA02G092110	`PF13639`	zf-RING_2	199	242	0.00057	20.8
TkA02G092110	`PF13445`	zf-RING_UBOX	200	240	7.1e-08	33.0
TkA02G092110	`PF00097`	zf-C3HC4	200	242	6.6e-05	23.4
TkA02G092110	`PF13923`	zf-C3HC4_2	200	242	0.00018	22.0
TkA02G092110	`PF15227`	zf-C3HC4_4	200	242	0.0025	18.6
TkA02G092110	`PF14634`	zf-RING_5	200	243	0.021	15.5
TkA02G092110	`PF21363`	TRAF3_RING	212	224	0.77	10.2
TkA02G092110	`PF04423`	Rad50_zn_hook	238	260	5.3	7.6
TkA02G092110	`PF13445`	zf-RING_UBOX	239	250	7.1e-08	33.0
TkA02G092110	`PF15227`	zf-C3HC4_4	322	328	0.0025	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card