TkA02G091640 | RubberDandelionOmics

Gene overview

TkA02G091640

Reference: TK1151 Chr: Chr02 Coordinates: 23877147-23878986 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

794 bp · TkA02G091640|TK1151|cDNA

AAATTAAAAATACACGAAGTAGAGAAAAATAGTGGAACCCTCGCGCAGATCGAACGCAAGAAAACACATCCGAGCAATCGCCGTTACATCCAATCACTCCGCCGGCGATCCCGATGCGTCCCTCCGTCCGATCACCGTCCGTCATTGCAGCACTCGTCGCATCCTTTCTTTTCATTTTATCGCCGGTGTTCGCCTCTGAGTATGATCACAAGTATCAACCAGATGACAAAGTCACCCTTTGGGTGAATAAAGTTGGGCCT...

CDS

Download CDS FASTA

681 bp · TkA02G091640|TK1151|CDS

ATGCGTCCCTCCGTCCGATCACCGTCCGTCATTGCAGCACTCGTCGCATCCTTTCTTTTCATTTTATCGCCGGTGTTCGCCTCTGAGTATGATCACAAGTATCAACCAGATGACAAAGTCACCCTTTGGGTGAATAAAGTTGGGCCTTACAATAATCCACAAGAAACATACAATTTCTACAGTCTTCCATTTTGTCACCTACCTGGACATGCTGCACACAAGTGGGGTGGTCTTGAGAATGTGGAAAAGACCTCTGTCTG...

Protein

Download Protein FASTA

226 aa · TkA02G091640|TK1151|PROTEIN

MRPSVRSPSVIAALVASFLFILSPVFASEYDHKYQPDDKVTLWVNKVGPYNNPQETYNFYSLPFCHLPGHAAHKWGGLENVEKTSVCKLELDEPKVMQFKQAIENNYWFELFMDDLPLWGFVGELHDRNTDNKHMLFTHMNITLQYNKDQIIHVNLTQESPKPLEAGRTLDMTYSVKWTETNITFARRFDVYLDYHFFEHQLNARNSCFFVLVNCKNFLFFVSYEM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G091640`
TK1151 ID	TkA02G091640
OH-1004 ID	LXL04_016930
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.100
Protein coverage (%)	TK1151 89.823 / OH-1004 37.627 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G091640

Location Chr02:23877147-23878986 (-)

Description Similar to TMN1: Transmembrane 9 superfamily member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10950`	Transmembrane 9 superfamily member 1.	No verified direct reference in this release
`At1g14670`	Transmembrane 9 superfamily member 2.	No verified direct reference in this release
`At2g01970`	Transmembrane 9 superfamily member 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016930 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0072657 protein localization to membrane Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G10950

ath:AT2G01970

ath:AT5G37310

hsa:56889

mmu:107358

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.463

Rank 1 · TkA02G091640 · TK1151

Lysosome / Vacuole0.248

Rank 2 · TkA02G091640 · TK1151

Golgi apparatus0.217

Rank 3 · TkA02G091640 · TK1151

Cytoplasm0.167

Rank 4 · TkA02G091640 · TK1151

Extracellular0.110

Rank 5 · TkA02G091640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02990EMP7056-68 aa

PF02990EMP7079-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G091640	`PF02990`	EMP70	56	68	9.9e-26	91.2
TkA02G091640	`PF02990`	EMP70	79	214	9.9e-26	91.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940G0`	Arabidopsis thaliana	sp\|Q940G0\|TMN1_ARATH Transmembrane 9 superfamily member 1	62.300%	Swiss-Prot	High
`Q940S0`	Arabidopsis thaliana	sp\|Q940S0\|TMN2_ARATH Transmembrane 9 superfamily member 2	32.100%	Swiss-Prot	Medium
`Q9ZPS7`	Arabidopsis thaliana	sp\|Q9ZPS7\|TMN3_ARATH Transmembrane 9 superfamily member 3	30.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card