TkA02G086680 | RubberDandelionOmics

Gene overview

TkA02G086680

Reference: TK1151 Chr: Chr02 Coordinates: 22546506-22552673 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · TkA02G086680|TK1151|cDNA

ACATGAATGAATAATGGAAGGTTGGAGATGGTGAAGGTTGAAATGAAAACAAACTTCTGTCACCAACTTGTCAGAAACACAAAAGCCCCCCTTCTCTCTCTTCTCTCTCTCTCTCTCTCTCCACATTTGCAAGTGTGAACTGTGAATAGTGTGTGTAGCATCCCAAAAGATCAAAAAGCCAAAAACCTCTGTATCTCTCTTTCTCATGGAGAGAGAGAAAACCTCAGTTAGATAACTGCAAAATACTCCCCAAAACCAGA...

CDS

Download CDS FASTA

1281 bp · TkA02G086680|TK1151|CDS

ATGGCTTCCGCCAGCGTTGGACACGGCGGAGTTGGCAGTTCCAGACCTGTTGCCGGCTTCAATGAATCATCGTCTAGCTCAGTTGACTGGTTGGGGAGGGAGATGCTTGAGATGCGACTTAGTGACAAGGCGGAACAAGATGGCGAACGAGTGAGTGATAGTGAACCAGAGATAGTGCACGGTGTAGGTGCTGAAGCAGGACATGTAATAAGAACAACAATTGGTGGTCGTAATGGTCAGTCTAAACAGACTGTCAGTTA...

Protein

Download Protein FASTA

426 aa · TkA02G086680|TK1151|PROTEIN

MASASVGHGGVGSSRPVAGFNESSSSSVDWLGREMLEMRLSDKAEQDGERVSDSEPEIVHGVGAEAGHVIRTTIGGRNGQSKQTVSYIAEHVIGTGSFGVVFQAKCRETGEIVAIKKVLQDKRYKNRELQIMQMLDHPNVVALKHSFFSTTDKEELYLNLVLDFVPETVSRSARHYTRINQRMPLIYVKLYTYQICRALAYIHNCIGICHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G086680`
TK1151 ID	TkA02G086680
OH-1004 ID	LXL04_001334
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.600
Protein coverage (%)	TK1151 99.531 / OH-1004 99.532 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G086680

Location Chr02:22546506-22552673 (+)

Description Similar to ASK10: Shaggy-related protein kinase kappa

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57870`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At1g09840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g14640`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0030154 cell differentiation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09840

ath:AT1G57870

ath:AT5G14640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · TkA02G086680 · TK1151

Nucleus0.554

Rank 2 · TkA02G086680 · TK1151

Cell membrane0.058

Rank 3 · TkA02G086680 · TK1151

Mitochondrion0.043

Rank 4 · TkA02G086680 · TK1151

Endoplasmic reticulum0.030

Rank 5 · TkA02G086680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC182-126 aa

PF14531Kinase-like86-130 aa

PF00069Pkinase88-371 aa

PF07714PK_Tyr_Ser-Thr90-288 aa

PF05445Pox_ser-thr_kin173-230 aa

PF14531Kinase-like190-273 aa

PF01633Choline_kinase192-233 aa

PF03109ABC1205-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G086680	`PF03109`	ABC1	82	126	0.00012	22.0
TkA02G086680	`PF14531`	Kinase-like	86	130	0.0057	16.7
TkA02G086680	`PF00069`	Pkinase	88	371	6.6e-61	206.7
TkA02G086680	`PF07714`	PK_Tyr_Ser-Thr	90	288	2.4e-23	83.5
TkA02G086680	`PF05445`	Pox_ser-thr_kin	173	230	0.035	13.8
TkA02G086680	`PF14531`	Kinase-like	190	273	0.0057	16.7
TkA02G086680	`PF01633`	Choline_kinase	192	233	0.011	15.9
TkA02G086680	`PF03109`	ABC1	205	237	0.00012	22.0
TkA02G086680	`PF01636`	APH	207	235	0.27	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS6`	Arabidopsis thaliana	sp\|Q9FVS6\|KSG4_ARATH Shaggy-related protein kinase delta	84.600%	Swiss-Prot	High
`Q39019`	Arabidopsis thaliana	sp\|Q39019\|KSG10_ARATH Shaggy-related protein kinase kappa	83.800%	Swiss-Prot	High
`Q8VZD5`	Arabidopsis thaliana	sp\|Q8VZD5\|KSG5_ARATH Shaggy-related protein kinase epsilon	77.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card