TkA02G086140 | RubberDandelionOmics

Gene overview

TkA02G086140

Reference: TK1151 Chr: Chr02 Coordinates: 22399657-22408952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

868 bp · TkA02G086140|TK1151|cDNA

GTCGGATTCCCATGCTTCCTATCACCGCCTTTTCCACTTCCTAAGTCAGCAAGTAACCATAGTCGTATATCTCTCTTCATTGTGGACTCTCCATTGTGCTTTCGGAAGAAACGCTCGTATCATTATCAGGGACAAGTCGAGCAGTGGATTGATTTCGCTTCACTAGAAATCGACTCAAACATGGTGAGATGGTTTAGACCAAGATTCGGCTATGATAACTATGATGCTCCGGCGGAGGAGCTAGCAATTGCTAATTTAAA...

CDS

Download CDS FASTA

618 bp · TkA02G086140|TK1151|CDS

TCGGATTCCCATGCTTCCTATCACCGCCTTTTCCACTTCCTAAGTCAGCAAGTAACCATAGTCGTATATCTCTCTTCATTGTGGACTCTCCATTGTGCTTTCGGAAGAAACGCTCGTATCATTATCAGGTCTATCATAAAAAACACACGAATGACGTTTGGACAAGTCGAGCAGTGGATTGATTTCGCTTCACTAGAAATCGACTCAAACATGGTGAGATGGTTTAGACCAAGATTCGGCTATGATAACTATGATGCTCC...

Protein

Download Protein FASTA

205 aa · TkA02G086140|TK1151|PROTEIN

SDSHASYHRLFHFLSQQVTIVVYLSSLWTLHCAFGRNARIIIRSIIKNTRMTFGQVEQWIDFASLEIDSNMVRWFRPRFGYDNYDAPAEELAIANLKRALGVLNTYLASHDFLVGESVTLADIITTCNLYLGFKNLMTKTFTSEYPHIERYFWTMVDQPNFSKVLPKTKQRDVVPPVLYEKYPTQPKEDGPKKEENKESVKVEAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G086140`
TK1151 ID	TkA02G086140
OH-1004 ID	LXL04_016976
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 76.098 / OH-1004 9.817 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G086140

Location Chr02:22399657-22408952 (+)

Description Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57720`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release
`At1g09640`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0220500`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release
`Os02g0220600`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016976 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · TkA02G086140 · TK1151

Nucleus0.220

Rank 2 · TkA02G086140 · TK1151

Mitochondrion0.138

Rank 3 · TkA02G086140 · TK1151

Endoplasmic reticulum0.103

Rank 4 · TkA02G086140 · TK1151

Peroxisome0.072

Rank 5 · TkA02G086140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07395Mig-1447-92 aa

PF22041GST_C_747-61 aa

PF00043GST_C80-159 aa

PF22041GST_C_787-130 aa

PF14497GST_C_390-162 aa

PF13410GST_C_290-152 aa

PF21972Arc1p_N_like95-153 aa

PF17171GST_C_697-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G086140	`PF07395`	Mig-14	47	92	0.09	12.9
TkA02G086140	`PF22041`	GST_C_7	47	61	0.12	13.0
TkA02G086140	`PF00043`	GST_C	80	159	2.4e-10	41.2
TkA02G086140	`PF22041`	GST_C_7	87	130	0.12	13.0
TkA02G086140	`PF14497`	GST_C_3	90	162	2e-06	28.7
TkA02G086140	`PF13410`	GST_C_2	90	152	2.3e-06	28.3
TkA02G086140	`PF21972`	Arc1p_N_like	95	153	0.00042	21.3
TkA02G086140	`PF17171`	GST_C_6	97	124	0.11	13.0
TkA02G086140	`PF07395`	Mig-14	149	172	0.09	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVT2`	Arabidopsis thaliana	sp\|Q9FVT2\|EF1G2_ARATH Probable elongation factor 1-gamma 2	52.200%	Swiss-Prot	High
`O04487`	Arabidopsis thaliana	sp\|O04487\|EF1G1_ARATH Probable elongation factor 1-gamma 1	58.200%	Swiss-Prot	High
`Q6YW46`	Oryza sativa subsp. japonica	sp\|Q6YW46\|EF1G2_ORYSJ Elongation factor 1-gamma 2	50.300%	Swiss-Prot	High
`Q9ZRI7`	Oryza sativa subsp. japonica	sp\|Q9ZRI7\|EF1G1_ORYSJ Elongation factor 1-gamma 1	49.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card