TkA02G081520 | RubberDandelionOmics

Gene overview

TkA02G081520

Reference: TK1151 Chr: Chr02 Coordinates: 21183625-21184924 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

634 bp · TkA02G081520|TK1151|cDNA

CGTAATTCCGTACAGATGATATAGATAGGGCAGGCGTAGGTCTGAAGCTTTTAACATTCATTCGTCAAATCAACGCTAACTACTAGCAAATTCTCCATTCTCTTCACTCGATCGGCGATCGCATCCTTCAACTGTGCAAAACATGTCGGATGAAGTCGAATACCGTTGTTTCATCGGTGGCCTATCATGGTCAACATCTGATCGAGCTCTCAAAGACGCATTCACAAAGTTTGGACATCTTCTCGATGCAAAGGTGGTTG...

CDS

Download CDS FASTA

492 bp · TkA02G081520|TK1151|CDS

ATGTCGGATGAAGTCGAATACCGTTGTTTCATCGGTGGCCTATCATGGTCAACATCTGATCGAGCTCTCAAAGACGCATTCACAAAGTTTGGACATCTTCTCGATGCAAAGGTGGTTGTAGACAAGGAATCTGGTCGTTCACGTGGATTTGGTTTTGTGACCTTCGATGAAAAGCAAGCAATGGAAGATGCCATTGAAGCCATGAACGGAATTGATTTAGACGGAAGAAACATCACAGTAGACAAAGCTCAACCACAAGG...

Protein

Download Protein FASTA

163 aa · TkA02G081520|TK1151|PROTEIN

MSDEVEYRCFIGGLSWSTSDRALKDAFTKFGHLLDAKVVVDKESGRSRGFGFVTFDEKQAMEDAIEAMNGIDLDGRNITVDKAQPQGDRGGGGGRYGGRDDRYGGGRGGGGGGGRYGPDRNGDRNNGRSRNGGSGGGGGGGGSDRYGRDRSGPYERRSSGGFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G081520`
TK1151 ID	TkA02G081520
OH-1004 ID	LXL04_012590
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	37.100
Protein coverage (%)	TK1151 58.282 / OH-1004 38.482 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G081520

Location Chr02:21183625-21184924 (-)

Description Similar to RZ1C: Glycine-rich RNA-binding protein RZ1C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26420`	Binds RNA and DNA sequences with a preference to single-stranded nucleic acids.	No verified direct reference in this release
`At2g21660`	Plays a role in RNA transcription or processing during stress.	AtGRP7 is involved in the regulation of abscisic acid and stress responses in Arabidopsis.2006 · DOI: 10.2478/s11658-006-0042-2 Cold shock domain proteins and glycine-rich RNA-binding proteins from Arabidopsis thaliana can promote the cold adaptation process in Escherichia coli.2007 · DOI: 10.1093/nar/gkl1076 Auto-regulation of the circadian slave oscillator component AtGRP7 and regulation of its targets is impaired by a single RNA recognition motif point mutation.2007 · DOI: 10.1111/j.1365-313x.2007.03302.x Glycine-rich RNA-binding protein 7 affects abiotic stress responses by regulating stomata opening and closing in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03518.x The small glycine-rich RNA binding protein AtGRP7 promotes floral transition in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03591.x Reciprocal regulation of glycine-rich RNA-binding proteins via an interlocked feedback loop coupling alternative splicing to nonsense-mediated decay in Arabidopsis.2008 · DOI: 10.1093/nar/gkn847 RNA-protein interaction mediating post-transcriptional regulation in the circadian system.2009 · DOI: 10.1007/978-1-59745-289-2_21 Structural determinants crucial to the RNA chaperone activity of glycine-rich RNA-binding proteins 4 and 7 in Arabidopsis thaliana during the cold adaptation process.2011 · DOI: 10.1093/jxb/err101 Structure function analysis of an ADP-ribosyltransferase type III effector and its RNA-binding target in plant immunity.2011 · DOI: 10.1074/jbc.m111.290122 An hnRNP-like RNA-binding protein affects alternative splicing by in vivo interaction with transcripts in Arabidopsis thaliana.2012 · DOI: 10.1093/nar/gks873 A Plant SMALL RNA-BINDING PROTEIN 1 Family Mediates Cell-to-Cell Trafficking of RNAi Signals.2020 · DOI: 10.1016/j.molp.2019.12.001 AtGRP7, a nuclear RNA-binding protein as a component of a circadian-regulated negative feedback loop in Arabidopsis thaliana.1997 · DOI: 10.1073/pnas.94.16.8515
`At4g39260`	Plays a role in RNA transcription or processing during stress.	Reciprocal regulation of glycine-rich RNA-binding proteins via an interlocked feedback loop coupling alternative splicing to nonsense-mediated decay in Arabidopsis.2008 · DOI: 10.1093/nar/gkn847 Quantitative analysis of single-molecule RNA-protein interaction.2009 · DOI: 10.1016/j.bpj.2009.03.022 An hnRNP-like RNA-binding protein affects alternative splicing by in vivo interaction with transcripts in Arabidopsis thaliana.2012 · DOI: 10.1093/nar/gks873

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012590 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016070 RNA metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048026 positive regulation of mRNA splicing, via spliceosome Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0000166 nucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT1G60650

ath:AT3G26420

ath:AT5G04280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.831

Rank 1 · TkA02G081520 · TK1151

Cytoplasm0.434

Rank 2 · TkA02G081520 · TK1151

Extracellular0.111

Rank 3 · TkA02G081520 · TK1151

Cell membrane0.041

Rank 4 · TkA02G081520 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA02G081520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16367RRM_78-68 aa

PF00076RRM_110-79 aa

PF18938aRib54-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G081520	`PF16367`	RRM_7	8	68	0.00054	20.6
TkA02G081520	`PF00076`	RRM_1	10	79	2.8e-21	75.9
TkA02G081520	`PF18938`	aRib	54	82	0.2	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIN3`	Arabidopsis thaliana	sp\|Q9LIN3\|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A	76.500%	Swiss-Prot	Medium
`Q03250`	Arabidopsis thaliana	sp\|Q03250\|RBG7_ARATH Glycine-rich RNA-binding protein 7	62.800%	Swiss-Prot	Medium
`Q03251`	Arabidopsis thaliana	sp\|Q03251\|RBG8_ARATH Glycine-rich RNA-binding protein 8	61.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card