TkA02G076440 | RubberDandelionOmics

Gene overview

TkA02G076440

Reference: TK1151 Chr: Chr02 Coordinates: 19842799-19844380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · TkA02G076440|TK1151|cDNA

TCCATCAACAGGTGCAGGCAGGAGAACATCAACCATTTCCCAAAGTGACAAAGGCGGTGATGGAATTAAAATAGAAGATTCTCACACAGACAGAAGCTTTGGAGAGAAAAAACTAAGAACATCAGTAGAAGAAGGCCCTTCAATAACCGAGCTAAGTGGCTACAATTTCAAAAGACAAGAATTTTGAATCGAATACGATAACGATGCCGAACAATTACTCGCTGACATGGAATTCAAAGAAGCCGACACCGATGCTGAAC...

CDS

Download CDS FASTA

627 bp · TkA02G076440|TK1151|CDS

ATGCGCTTTCATACTAAAGAAGAACATCAAGAGTTGCTTAAAACCGTCATTGAAGAACACCGTATTCGCAAAAGAATCAAGGATTTACAGGAAGCACGAGCTGCTGGGTGTCGTACGTCTGCGGATGCTGAAAGATATATTGAACAGAACAGGAAAAGAGAAGCTGATGAAAATTCACGGAGGATTAATAATACTAATAATAATAATATTAGTAATAATATAAATAATGTTAATAATAATAATAGTAATAATATACAGCC...

Protein

Download Protein FASTA

208 aa · TkA02G076440|TK1151|PROTEIN

MRFHTKEEHQELLKTVIEEHRIRKRIKDLQEARAAGCRTSADAERYIEQNRKREADENSRRINNTNNNNISNNINNVNNNNSNNIQPGPSGKFLQRANHLKRDVDGKDTGGGLAIASLDDWDVTGHLGADLLSEAEKRLCTEIRVLPVHYLSMLEKLSIEILNGNISQKSDAHRLFNVDATKVTPTKTNKHQQHPKAPPQNIDVGAKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G076440`
TK1151 ID	TkA02G076440
OH-1004 ID	LXL04_001820
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.100
Protein coverage (%)	TK1151 87.981 / OH-1004 32.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G076440

Location Chr02:19842799-19844380 (-)

Description Similar to ADA2: Transcriptional adapter ADA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07740`	Required for the function of some acidic activation domains, which activate transcription from a distant site.	No verified direct reference in this release
`At4g16420`	Required for the function of some acidic activation domains, which activate transcription from a distant site.	Disruption mutations of ADA2b and GCN5 transcriptional adaptor genes dramatically affect Arabidopsis growth, development, and gene expression.2003 · DOI: 10.1105/tpc.007922 PROPORZ1, a putative Arabidopsis transcriptional adaptor protein, mediates auxin and cytokinin signals in the control of cell proliferation.2003 · DOI: 10.1016/s0960-9822(03)00327-0 Arabidopsis thaliana transcriptional co-activators ADA2b and SGF29a are implicated in salt stress responses.2011 · DOI: 10.1007/s00425-010-1337-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0750800`	Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity).	Rice Homeodomain Protein WOX11 Recruits a Histone Acetyltransferase Complex to Establish Programs of Cell Proliferation of Crown Root Meristem.2017 · DOI: 10.1105/tpc.16.00908

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001820 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000183 rDNA heterochromatin formation Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010520 regulation of reciprocal meiotic recombination Biological Process

GO:0010811 positive regulation of cell-substrate adhesion Biological Process

GO:0030447 filamentous growth Biological Process

KEGG gene cross-reference

ath:AT3G07740

ath:AT4G16420

cal:CAALFM_C110860CA

dosa:Os03g0750800

sce:YDR448W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · TkA02G076440 · TK1151

Nucleus0.447

Rank 2 · TkA02G076440 · TK1151

Cell membrane0.074

Rank 3 · TkA02G076440 · TK1151

Mitochondrion0.045

Rank 4 · TkA02G076440 · TK1151

Golgi apparatus0.030

Rank 5 · TkA02G076440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07767Nop536-73 aa

PF22575Vir1p50-86 aa

PF24533Tri-helical_Ada2b_C131-153 aa

PF07767Nop53154-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G076440	`PF07767`	Nop53	6	73	0.015	15.4
TkA02G076440	`PF22575`	Vir1p	50	86	5.2	5.3
TkA02G076440	`PF24533`	Tri-helical_Ada2b_C	131	153	0.084	13.4
TkA02G076440	`PF07767`	Nop53	154	193	0.015	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFD5`	Arabidopsis thaliana	sp\|Q9SFD5\|TAD2A_ARATH Transcriptional adapter ADA2a	46.800%	Swiss-Prot	Medium
`Q9ATB4`	Arabidopsis thaliana	sp\|Q9ATB4\|TAD2B_ARATH Transcriptional adapter ADA2b	40.400%	Swiss-Prot	Medium
`Q75LL6`	Oryza sativa subsp. japonica	sp\|Q75LL6\|TADA2_ORYSJ Transcriptional adapter ADA2	40.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card