TkA02G076300 | RubberDandelionOmics

Gene overview

TkA02G076300

Reference: TK1151 Chr: Chr02 Coordinates: 19778342-19781872 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1517 bp · TkA02G076300|TK1151|cDNA

AAAAAACTAAAGAAAGGTCCTGCTGCTTTCGATTGAATCAAAGCCCGAGCGAAGAGTGGGTTGTCGGGCGATATCATGATGCCTCCTCTTTCTCCCCCCTCTCTTTCCCCCAAATCCCCTCTAACCTCTTCCACCTAAACCTACATTCTAATTCACCAAAATCAGCTTCTTTTTCAATAGATTGCCTTTCTTTTCCAACAATTTATCCCAATCGACATCATTCTTTTCATTTGATCTGTTCGATTTCATCATCCCTATCT...

CDS

Download CDS FASTA

1344 bp · TkA02G076300|TK1151|CDS

ATGGAGCCTCGTGTGGGGAATAAGTATCGACTTGGCCGGAAGATCGGTAGCGGCTCGTTTGGAGAGATCTACCTTGGTACTAATATTCAGACGAATGAAGAAGTTGCTATTAAGCTGGAAAATATCAAGACAAAGCATCCACAATTGCTATATGAATCAAAGCTATATAAGATCCTGCAAGGAGGAACTGGAATTCCAAACGTGAGATGGTTTGGTGTTGAAGGAGACTACAATGTTCTAGTCCTGGATTTATTGGGTCC...

Protein

Download Protein FASTA

447 aa · TkA02G076300|TK1151|PROTEIN

MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKILQGGTGIPNVRWFGVEGDYNVLVLDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVHCKSFLHRDLKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGNKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G076300`
TK1151 ID	TkA02G076300
OH-1004 ID	LXL04_032206
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G076300

Location Chr02:19778342-19781872 (+)

Description Similar to CKL2: Casein kinase 1-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72710`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g26100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g57015`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At2g19470`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g44100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004712 protein serine/threonine/tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03930

ath:AT1G72710

ath:AT2G19470

ath:AT4G26100

ath:AT5G57015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · TkA02G076300 · TK1151

Nucleus0.377

Rank 2 · TkA02G076300 · TK1151

Cell membrane0.086

Rank 3 · TkA02G076300 · TK1151

Mitochondrion0.064

Rank 4 · TkA02G076300 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA02G076300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase9-226 aa

PF07714PK_Tyr_Ser-Thr11-233 aa

PF05445Pox_ser-thr_kin108-136 aa

PF17667Pkinase_fungal118-206 aa

PF01636APH123-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G076300	`PF00069`	Pkinase	9	226	1.3e-25	91.0
TkA02G076300	`PF07714`	PK_Tyr_Ser-Thr	11	233	5.4e-14	52.8
TkA02G076300	`PF05445`	Pox_ser-thr_kin	108	136	0.029	14.1
TkA02G076300	`PF17667`	Pkinase_fungal	118	206	1.3e-06	28.1
TkA02G076300	`PF01636`	APH	123	153	0.064	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAI5`	Arabidopsis thaliana	sp\|Q9CAI5\|CKL2_ARATH Casein kinase 1-like protein 2	73.700%	Swiss-Prot	High
`P42158`	Arabidopsis thaliana	sp\|P42158\|CKL1_ARATH Casein kinase 1-like protein 1	71.800%	Swiss-Prot	High
`Q8VYK9`	Arabidopsis thaliana	sp\|Q8VYK9\|CKL12_ARATH Casein kinase 1-like protein 12	71.700%	Swiss-Prot	High
`Q9ZUP4`	Arabidopsis thaliana	sp\|Q9ZUP4\|CKL5_ARATH Casein kinase 1-like protein 5	64.900%	Swiss-Prot	High
`Q9FFH8`	Arabidopsis thaliana	sp\|Q9FFH8\|CKL7_ARATH Casein kinase 1-like protein 7	81.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card