TkA02G074620 | RubberDandelionOmics

Gene overview

TkA02G074620

Reference: TK1151 Chr: Chr02 Coordinates: 19346404-19348165 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · TkA02G074620|TK1151|cDNA

TTGATATTTGGTTTGAATTCATGCAAGGACCATACAGTTAAGGTCAGAAATTCTCCGACTTTGAAAAATACTTCATGGGATAATAAGGAAGATATTCGTAGCATTTCAATGATCTTAATGGATGAGAAGGGTTCTAAGATAGAATGTAATGTGAAAAAACTATTTTACATTAAATATTTGGAACTATTTGAAGAATATGATGTGGTTTATATTCGAAACTCTACTCTTGGCACACATTTAGGCAATATGAAATATATTGA...

CDS

Download CDS FASTA

1074 bp · TkA02G074620|TK1151|CDS

TTGATATTTGGTTTGAATTCATGCAAGGACCATACAGTTAAGGTCAGAAATTCTCCGACTTTGAAAAATACTTCATGGGATAATAAGGAAGATATTCGTAGCATTTCAATGATCTTAATGGATGAGAAGGGTTCTAAGATAGAATGTAATGTGAAAAAACTATTTTACATTAAATATTTGGAACTATTTGAAGAATATGATGTGGTTTATATTCGAAACTCTACTCTTGGCACACATTTAGGCAATATGAAATATATTGA...

Protein

Download Protein FASTA

357 aa · TkA02G074620|TK1151|PROTEIN

LIFGLNSCKDHTVKVRNSPTLKNTSWDNKEDIRSISMILMDEKGSKIECNVKKLFYIKYLELFEEYDVVYIRNSTLGTHLGNMKYIDHVKQMHFKITVTKCNDFDGPTHGFSFANFRSILDNSLPFNLTVDVIGEVINIPPLEKLKGQNHDTLQQNVDLKDLSGITIIVTFWGNAAQELMDYVANHSDSKCLIIIIQFGKLRIFNGVTYVNNSMVGTKIFCNSDIEEINSFKKKLYSLKVFDTSSSSRTIGSLTFYSLRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G074620`
TK1151 ID	TkA02G074620
OH-1004 ID	LXL04_017108
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 82.073 / OH-1004 92.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G074620`
Location	Chr02:19346404-19348165 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017108` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0007141 male meiosis I Biological Process GO:0009555 pollen development Biological Process GO:0010224 response to UV-B Biological Process GO:0048232 male gamete generation Biological Process GO:0051026 chiasma assembly Biological Process
KEGG gene cross-reference	ath:AT2G06510 ath:AT4G19130 ath:AT5G08020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.903

Rank 1 · TkA02G074620 · TK1151

Cytoplasm0.176

Rank 2 · TkA02G074620 · TK1151

Cell membrane0.022

Rank 3 · TkA02G074620 · TK1151

Mitochondrion0.021

Rank 4 · TkA02G074620 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA02G074620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16900REPA_OB_227-49 aa

PF02721DUF22331-121 aa

PF01336tRNA_anti-codon36-72 aa

PF16900REPA_OB_2126-207 aa

PF01336tRNA_anti-codon155-202 aa

PF01336tRNA_anti-codon248-261 aa

PF22926C1-like_CT302-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G074620	`PF16900`	REPA_OB_2	27	49	1.1e-07	32.4
TkA02G074620	`PF02721`	DUF223	31	121	3.6e-09	37.5
TkA02G074620	`PF01336`	tRNA_anti-codon	36	72	0.12	13.1
TkA02G074620	`PF16900`	REPA_OB_2	126	207	1.1e-07	32.4
TkA02G074620	`PF01336`	tRNA_anti-codon	155	202	0.12	13.1
TkA02G074620	`PF01336`	tRNA_anti-codon	248	261	0.12	13.1
TkA02G074620	`PF22926`	C1-like_CT	302	326	1.2	9.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card