TkA02G072180 | RubberDandelionOmics

Gene overview

TkA02G072180

Reference: TK1151 Chr: Chr02 Coordinates: 18706839-18709777 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2058 bp · TkA02G072180|TK1151|cDNA

ACCGAACTCCTTCCGACTTTCCGCATATTTTCGTTATTACTTAATTCCTCGATCTCCTACACCACCACCCTCCCCTCCATACTCCTATCCCCATTTTTCATGTATAAAACTGTCAGAAATCTGGGATCTCTTTCAAAGATTCATAACAATTAAAATCCCCAATTTTGTCCCAATTCAAAATACGACGACCCTGTTTCAGATCAATGGCTTCCATTAACATGGCGTCGTCTTCCTCCTCGCAACTACTACGCCCCAAGATG...

CDS

Download CDS FASTA

1542 bp · TkA02G072180|TK1151|CDS

ATGGCTTCCATTAACATGGCGTCGTCTTCCTCCTCGCAACTACTACGCCCCAAGATGAACACAAACTATAGTTCGTTCAGTGGTCTTCACTCTCTAAACATTCTTTCCCAAAACACCAAATTGTGCTCCATAAGTAAATCCGATTGTTTATTCAAATCTTCATTCTTACCGGTCGACTCATGGAAAACTGCTGTTAGCCTTCCATCTGGGATTGAAATACAGACTGATTCAACAATTTTGACGACACTAGAAGAAGAATT...

Protein

Download Protein FASTA

513 aa · TkA02G072180|TK1151|PROTEIN

MASINMASSSSSQLLRPKMNTNYSSFSGLHSLNILSQNTKLCSISKSDCLFKSSFLPVDSWKTAVSLPSGIEIQTDSTILTTLEEELNSFPRDVHGYDLDSPTPGFSSIPEAIEDIRQGKMVVVVDDEDRENEGDLIMAASSVTPEAMAFFVKHGTGIVCVSMKAEDLERLQLPLMVTRNQDKNRTAFTVSVDCKHHTTTGVSANDRATTIKALASKESKPDDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAILAGFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G072180`
TK1151 ID	TkA02G072180
OH-1004 ID	LXL04_017151
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 97.856 / OH-1004 47.448 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G072180

Location Chr02:18706839-18709777 (-)

Description Similar to RIBA1: Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64300`	Involved in riboflavin biosynthesis.	Deficiency in riboflavin biosynthesis affects tetrapyrrole biosynthesis in etiolated Arabidopsis tissue.2012 · DOI: 10.1007/s11103-011-9846-1 Arabidopsis RIBA proteins: two out of three isoforms have lost their bifunctional activity in riboflavin biosynthesis.2012 · DOI: 10.3390/ijms131114086
`At2g22450`	Involved in riboflavin biosynthesis.	Arabidopsis RIBA proteins: two out of three isoforms have lost their bifunctional activity in riboflavin biosynthesis.2012 · DOI: 10.3390/ijms131114086
`At5g59750`	Involved in riboflavin biosynthesis.	Arabidopsis RIBA proteins: two out of three isoforms have lost their bifunctional activity in riboflavin biosynthesis.2012 · DOI: 10.3390/ijms131114086

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0481950`	Involved in riboflavin biosynthesis.	No verified direct reference in this release
`Os02g0572400`	Involved in riboflavin biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017151 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003935 GTP cyclohydrolase II activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G64300

dosa:Os02g0572400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA02G072180 · TK1151

Mitochondrion0.051

Rank 2 · TkA02G072180 · TK1151

Nucleus0.023

Rank 3 · TkA02G072180 · TK1151

Cytoplasm0.021

Rank 4 · TkA02G072180 · TK1151

Cell membrane0.013

Rank 5 · TkA02G072180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00925GTP_cyclohydro2110-131 aa

PF00926DHBP_synthase111-301 aa

PF00925GTP_cyclohydro2145-165 aa

PF00925GTP_cyclohydro2314-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G072180	`PF00925`	GTP_cyclohydro2	110	131	4.5e-72	241.7
TkA02G072180	`PF00926`	DHBP_synthase	111	301	1.4e-88	296.2
TkA02G072180	`PF00925`	GTP_cyclohydro2	145	165	4.5e-72	241.7
TkA02G072180	`PF00925`	GTP_cyclohydro2	314	477	4.5e-72	241.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P47924`	Arabidopsis thaliana	sp\|P47924\|RIBA1_ARATH Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic	70.600%	Swiss-Prot	High
`Q6NLQ7`	Arabidopsis thaliana	sp\|Q6NLQ7\|RIBA2_ARATH Monofunctional riboflavin biosynthesis protein RIBA 2, chloroplastic	69.400%	Swiss-Prot	High
`Q9FN89`	Arabidopsis thaliana	sp\|Q9FN89\|RIBA3_ARATH Monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic	62.600%	Swiss-Prot	High
`Q6Z234`	Oryza sativa subsp. japonica	sp\|Q6Z234\|RIBA1_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic	76.100%	Swiss-Prot	High
`Q0E079`	Oryza sativa subsp. japonica	sp\|Q0E079\|RIBA2_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic	80.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card