TkA02G071470 | RubberDandelionOmics

Gene overview

TkA02G071470

Reference: TK1151 Chr: Chr02 Coordinates: 18533765-18539974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3582 bp · TkA02G071470|TK1151|cDNA

TTGTTATTGACTGGTGTCATTCCTAATTTCATTTTCTTCCGCTCGTATAACCATTATCAACCGAGGAGGAAGATCTATCAATCAACCGGTGTTAGAACATGGCGGCAGCTCGTTCAATCTTCGTTGGACTCATCCGGAATTACAGCAGACAGACGACACCTATAGTTCACTGAGGTTCCTGTCTTCGTCGTCTTCATCTTCAACGGCTTCGAAATTAGAAATCGTCTATGACGAATCGCCGATTTCGGTTCCAGAAGATG...

CDS

Download CDS FASTA

489 bp · TkA02G071470|TK1151|CDS

ATGAAGATTCTCAATCTTTTCATCTTGTTATGGCTTTGTAGTGGTGGGAGGTTGCTTGATCGTATGTGGGAAGACGGTTTGTTTTCAGAGCAAAAAGCCGCTAATTTAATCAAAGAATTGATGTTGGTTCTTAAATATTGTCATGATATGGGTGTCATTCATCGCGATATAAAACCCGAAAATATCCTTCTTTCTGCTAATGGTACCATAAAGCTTGCCGATTTCGGATTGGCCGCTAGAATCGCTAACGGTCAGAGTTT...

Protein

Download Protein FASTA

162 aa · TkA02G071470|TK1151|PROTEIN

MKILNLFILLWLCSGGRLLDRMWEDGLFSEQKAANLIKELMLVLKYCHDMGVIHRDIKPENILLSANGTIKLADFGLAARIANGQSLYGVVGSPAYVAPEVLSGGYTEKVDIWSAGVVLHAVLVGYLPFGGDSVNTVFEAVKNVSVDFQGNFGNRYLNLRVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G071470`
TK1151 ID	TkA02G071470
OH-1004 ID	LXL04_031130
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.100
Protein coverage (%)	TK1151 84.568 / OH-1004 28.842 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G071470

Location Chr02:18533765-18539974 (-)

Description Similar to PEPKR2: Serine/threonine-protein kinase PEPKR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12680`	Serine/threonine-protein kinase PEPKR2.	No verified direct reference in this release
`At1g76040`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At4g09570`	May play a role in signal transduction pathways that involve calcium as a second messenger.	A novel yeast two-hybrid approach to identify CDPK substrates: characterization of the interaction between AtCPK11 and AtDi19, a nuclear zinc finger protein.2006 · DOI: 10.1016/j.febslet.2006.01.013 Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050666
`At1g08650`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031130 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12680

ath:AT1G50700

ath:AT1G76040

dosa:Os03g0788500

gmx:547825

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · TkA02G071470 · TK1151

Nucleus0.413

Rank 2 · TkA02G071470 · TK1151

Mitochondrion0.065

Rank 3 · TkA02G071470 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA02G071470 · TK1151

Peroxisome0.054

Rank 5 · TkA02G071470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase6-140 aa

PF07714PK_Tyr_Ser-Thr6-143 aa

PF12330Haspin_kinase6-82 aa

PF06293Kdo23-75 aa

PF10707YrbL-PhoP_reg31-69 aa

PF07387Seadorna_VP737-75 aa

PF14531Kinase-like40-134 aa

PF03109ABC141-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G071470	`PF00069`	Pkinase	6	140	8.8e-42	144.0
TkA02G071470	`PF07714`	PK_Tyr_Ser-Thr	6	143	2.8e-19	70.2
TkA02G071470	`PF12330`	Haspin_kinase	6	82	0.042	13.6
TkA02G071470	`PF06293`	Kdo	23	75	0.018	15.2
TkA02G071470	`PF10707`	YrbL-PhoP_reg	31	69	0.14	12.6
TkA02G071470	`PF07387`	Seadorna_VP7	37	75	0.056	13.2
TkA02G071470	`PF14531`	Kinase-like	40	134	2.5e-05	24.4
TkA02G071470	`PF03109`	ABC1	41	83	0.00028	20.9
TkA02G071470	`PF17667`	Pkinase_fungal	48	104	0.055	12.9
TkA02G071470	`PF01636`	APH	48	76	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W490`	Arabidopsis thaliana	sp\|Q8W490\|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2	69.300%	Swiss-Prot	High
`Q8RWL2`	Arabidopsis thaliana	sp\|Q8RWL2\|CDPKT_ARATH Calcium-dependent protein kinase 29	45.900%	Swiss-Prot	Medium
`Q38869`	Arabidopsis thaliana	sp\|Q38869\|CDPK4_ARATH Calcium-dependent protein kinase 4	45.500%	Swiss-Prot	Medium
`Q9SPK4`	Arabidopsis thaliana	sp\|Q9SPK4\|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1	48.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card