TkA02G061640 | RubberDandelionOmics

Gene overview

TkA02G061640

Reference: TK1151 Chr: Chr02 Coordinates: 16070579-16074053 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA02G061640|TK1151|cDNA

ATGCATACACTTCAAAAAGGCGTGAATGGAGTTCCATACCTTCTAAAAGGCATGATTGCAGTTCCACCCCTTCAAAAAGGCGTGAATGGAGTGCTAGGACCTCAAAAAGGCGTGAATAGAGTGATGGGAGACCCAATTGGGATTTTGAAAGTTATCGTTGTTCGAGGGAAGAATCTTGTAATCCGCGATTTCAAAACCAGTGATCCTTACGTCATCCTCAAGCTCGGAAACCAGACCGCGAAGACGAAGGAAGTGTTTGA...

CDS

Download CDS FASTA

399 bp · TkA02G061640|TK1151|CDS

ATGCATACACTTCAAAAAGGCGTGAATGGAGTTCCATACCTTCTAAAAGGCATGATTGCAGTTCCACCCCTTCAAAAAGGCGTGAATGGAGTGCTAGGACCTCAAAAAGGCGTGAATAGAGTGATGGGAGACCCAATTGGGATTTTGAAAGTTATCGTTGTTCGAGGGAAGAATCTTGTAATCCGCGATTTCAAAACCAGTGATCCTTACGTCATCCTCAAGCTCGGAAACCAGACCGCGAAGACGAAGGAAGTGTTTGA...

Protein

Download Protein FASTA

132 aa · TkA02G061640|TK1151|PROTEIN

MHTLQKGVNGVPYLLKGMIAVPPLQKGVNGVLGPQKGVNRVMGDPIGILKVIVVRGKNLVIRDFKTSDPYVILKLGNQTAKTKEVFDKDRFKSDDKMGHAHINIQPLMQKTGMNAPNRVTPGAITPCGYPYH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G061640`
TK1151 ID	TkA02G061640
OH-1004 ID	LXL04_026978
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.000
Protein coverage (%)	TK1151 46.212 / OH-1004 53.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G061640

Location Chr02:16070579-16074053 (-)

Description Similar to CAR11: Protein C2-DOMAIN ABA-RELATED 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47710`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release
`At3g07940`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	No verified direct reference in this release
`At2g01540`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X479`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (By similarity).	No verified direct reference in this release
`Os02g0327000`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (By similarity).	Constitutive expression of a rice GTPase-activating protein induces defense responses.2008 · DOI: 10.1111/j.1469-8137.2008.02473.x An ancient P-loop GTPase in rice is regulated by a higher plant-specific regulatory protein.2010 · DOI: 10.1074/jbc.m110.172080 Site-directed Mutagenesis Shows the Significance of Interactions with Phospholipids and the G-protein OsYchF1 for the Physiological Functions of the Rice GTPase-activating Protein 1 (OsGAP1).2015 · DOI: 10.1074/jbc.m115.655639

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026978 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G66360

ath:AT1G70790

ath:AT5G47710

dosa:Os02g0327000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · TkA02G061640 · TK1151

Nucleus0.204

Rank 2 · TkA02G061640 · TK1151

Cell membrane0.161

Rank 3 · TkA02G061640 · TK1151

Endoplasmic reticulum0.150

Rank 4 · TkA02G061640 · TK1151

Extracellular0.142

Rank 5 · TkA02G061640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C247-83 aa

PF00168C284-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G061640	`PF00168`	C2	47	83	2.7e-10	41.1
TkA02G061640	`PF00168`	C2	84	112	2.7e-10	41.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIK8`	Arabidopsis thaliana	sp\|Q9FIK8\|CAR11_ARATH Protein C2-DOMAIN ABA-RELATED 11	46.700%	Swiss-Prot	Medium
`Q8L7A4`	Arabidopsis thaliana	sp\|Q8L7A4\|AGD11_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD11	42.000%	Swiss-Prot	Low
`Q9ZVF1`	Arabidopsis thaliana	sp\|Q9ZVF1\|CAR10_ARATH Protein C2-DOMAIN ABA-RELATED 10	37.900%	Swiss-Prot	Medium
`A2X479`	Oryza sativa subsp. indica	sp\|A2X479\|GAP1_ORYSI GTPase activating protein 1	37.600%	Swiss-Prot	Medium
`Q6YWF1`	Oryza sativa subsp. japonica	sp\|Q6YWF1\|GAP1_ORYSJ GTPase activating protein 1	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card