TkA02G054700 | RubberDandelionOmics

Gene overview

TkA02G054700

Reference: TK1151 Chr: Chr02 Coordinates: 14275025-14276483 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA02G054700|TK1151|cDNA

ATGAACAGAAAACGTACCCAAAATCAGTCACCGACGATGACCTCTTCTGCCGTCCAATGGCCACCGTCTACTAAACGGCATTGCACGGGCACATCATTATCAACCACAAAAAACGAACCAGCCCACTATATGTTAAAGATTGAGTCTTTCTCTATTCTTTCTGAAAATCCCTCTATCATAATCGAATCTGATGTTTTTGAAGCCAGCGGTTATAAATGGAAACTAGAGTTGCATCCTAATGGAAACAAAGAGGAAGATGG...

CDS

Download CDS FASTA

588 bp · TkA02G054700|TK1151|CDS

ATGAACAGAAAACGTACCCAAAATCAGTCACCGACGATGACCTCTTCTGCCGTCCAATGGCCACCGTCTACTAAACGGCATTGCACGGGCACATCATTATCAACCACAAAAAACGAACCAGCCCACTATATGTTAAAGATTGAGTCTTTCTCTATTCTTTCTGAAAATCCCTCTATCATAATCGAATCTGATGTTTTTGAAGCCAGCGGTTATAAATGGAAACTAGAGTTGCATCCTAATGGAAACAAAGAGGAAGATGG...

Protein

Download Protein FASTA

195 aa · TkA02G054700|TK1151|PROTEIN

MNRKRTQNQSPTMTSSAVQWPPSTKRHCTGTSLSTTKNEPAHYMLKIESFSILSENPSIIIESDVFEASGYKWKLELHPNGNKEEDGANHLSLYLIICDGKSRVNGWNVLVDVKFFVYDHIARNYVTFQDADGNRTRFHEKKLKWGFDKLVSLDQFKDSSKGYLFNDSFVFGAEVFVVPDYTLKDRCFSITKPPC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G054700`
TK1151 ID	TkA02G054700
OH-1004 ID	LXL04_017320
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 99.487 / OH-1004 53.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G054700`
Location	Chr02:14275025-14276483 (-)
Description	Similar to UBP12: Ubiquitin carboxyl-terminal hydrolase 12
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017320` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0016579 protein deubiquitination Biological Process GO:0031647 regulation of protein stability Biological Process GO:0070646 protein modification by small protein removal Biological Process GO:2000280 regulation of root development Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference	ath:AT1G31390 ath:AT2G05420 ath:AT3G11910 ath:AT5G06600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.816

Rank 1 · TkA02G054700 · TK1151

Cytoplasm0.274

Rank 2 · TkA02G054700 · TK1151

Cell membrane0.058

Rank 3 · TkA02G054700 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA02G054700 · TK1151

Lysosome / Vacuole0.015

Rank 5 · TkA02G054700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21355TRAF-mep_MATH15-23 aa

PF22486MATH_242-175 aa

PF00917MATH50-177 aa

PF21355TRAF-mep_MATH67-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G054700	`PF21355`	TRAF-mep_MATH	15	23	2e-05	25.7
TkA02G054700	`PF22486`	MATH_2	42	175	4.4e-32	111.9
TkA02G054700	`PF00917`	MATH	50	177	5.3e-11	43.5
TkA02G054700	`PF21355`	TRAF-mep_MATH	67	170	2e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card