RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G053120
Reference: TK1151 Chr: Chr02 Coordinates: 13867567-13870057 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1920 bp · TkA02G053120|TK1151|cDNA

ATGGATCCTATTACTAATCCTTCTCCTTCAACTAATCCTACATCCAATTGCGCACCTAATTCCAAAAACAATGATCCAAACATGTTTCTCGTATCCTCACATCTTACTGGAAATGAAAACTACATGCAATGGAAATACTCCATTCAAATTGCTCTAGGAGCTAAGAAGAAAGTAGGATTCATAAATGGAACATCGAGTAAACCATCTACTGAAGGAACTGAGCTTGATGATTGGACAAAACACTTCTCAGAAAGCAATGG...

CDS

Download CDS FASTA

1920 bp · TkA02G053120|TK1151|CDS

ATGGATCCTATTACTAATCCTTCTCCTTCAACTAATCCTACATCCAATTGCGCACCTAATTCCAAAAACAATGATCCAAACATGTTTCTCGTATCCTCACATCTTACTGGAAATGAAAACTACATGCAATGGAAATACTCCATTCAAATTGCTCTAGGAGCTAAGAAGAAAGTAGGATTCATAAATGGAACATCGAGTAAACCATCTACTGAAGGAACTGAGCTTGATGATTGGACAAAACACTTCTCAGAAAGCAATGG...

Protein

Download Protein FASTA

639 aa · TkA02G053120|TK1151|PROTEIN

MDPITNPSPSTNPTSNCAPNSKNNDPNMFLVSSHLTGNENYMQWKYSIQIALGAKKKVGFINGTSSKPSTEGTELDDWTKHFSESNGPLIYQLQRQIASIHQGDSSVSKYYTKLKQLWDQLNCLMQLPMCNCGSAKAMSDFASSTHLMQFLMGLNDTYENLRNQILVLDPLPSVHKAYSMALSVEKQKEVQINFSTPPESAMFVKTSNHNADKKQISYCKVEPYNLIMSSSFRTLIAVFAITDSLCENRVLNTIVFVTIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G053120
TK1151 IDTkA02G053120
OH-1004 IDLXL04_016167
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)74.900
Protein coverage (%)TK1151 54.460 / OH-1004 28.014
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G053120
LocationChr02:13867567-13870057 (+)
DescriptionSimilar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_016167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006310 DNA recombination Biological Process
GO:0006508 proteolysis Biological Process
GO:0015074 DNA integration Biological Process
GO:0003676 nucleic acid binding Molecular Function
GO:0003964 RNA-directed DNA polymerase activity Molecular Function
GO:0004190 aspartic-type endopeptidase activity Molecular Function
GO:0004519 endonuclease activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-referenceNo functional description available
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600
Rank 1 · TkA02G053120 · TK1151
Nucleus0.375
Rank 2 · TkA02G053120 · TK1151
Mitochondrion0.079
Rank 3 · TkA02G053120 · TK1151
Cell membrane0.051
Rank 4 · TkA02G053120 · TK1151
Endoplasmic reticulum0.048
Rank 5 · TkA02G053120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244Retrotran_gag_325-69 aa
PF14223Retrotran_gag_249-118 aa
PF30901PEG10-RTL1_C-capsid94-121 aa
PF14223Retrotran_gag_2103-124 aa
PF30379SLU7_N130-135 aa
PF00098zf-CCHC131-134 aa
PF30901PEG10-RTL1_C-capsid139-186 aa
PF13358DDE_3143-200 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G053120PF14244Retrotran_gag_325696.1e-1349.1
TkA02G053120PF14223Retrotran_gag_2491186.9e-1142.9
TkA02G053120PF30901PEG10-RTL1_C-capsid941210.004117.8
TkA02G053120PF14223Retrotran_gag_21031246.9e-1142.9
TkA02G053120PF30379SLU7_N1301350.989.7
TkA02G053120PF00098zf-CCHC1311340.0002521.7
TkA02G053120PF30901PEG10-RTL1_C-capsid1391860.004117.8
TkA02G053120PF13358DDE_31432000.08613.4
TkA02G053120PF14223Retrotran_gag_23184246.9e-1142.9
TkA02G053120PF30379SLU7_N5225380.989.7
TkA02G053120PF00098zf-CCHC5245400.0002521.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser