TkA02G047890 | RubberDandelionOmics

Gene overview

TkA02G047890

Reference: TK1151 Chr: Chr02 Coordinates: 12444655-12445956 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · TkA02G047890|TK1151|cDNA

ATGGAGGCCTTTTTGGAGCAGATTCCACATCTTAAAACCTTCAAGTTGGAGCAGATGAATTCAATCACAGGAAACTTTGATAACAACAAAGTTATTGGAGAAGGTGGATTCGGGAAGGTATATGCGGGAGTACTTTCTGACTCTGAGGGACAAATCACAGTTGCGTTGAAGCGTCTCAGTAAAAACTCCGGGCAAGGAAACCCTGAGTTCTTGAAAGAGATATTAATGCTTTCTCACTATACACATAATAATCTCATATA...

CDS

Download CDS FASTA

906 bp · TkA02G047890|TK1151|CDS

ATGGAGGCCTTTTTGGAGCAGATTCCACATCTTAAAACCTTCAAGTTGGAGCAGATGAATTCAATCACAGGAAACTTTGATAACAACAAAGTTATTGGAGAAGGTGGATTCGGGAAGGTATATGCGGGAGTACTTTCTGACTCTGAGGGACAAATCACAGTTGCGTTGAAGCGTCTCAGTAAAAACTCCGGGCAAGGAAACCCTGAGTTCTTGAAAGAGATATTAATGCTTTCTCACTATACACATAATAATCTCATATA...

Protein

Download Protein FASTA

301 aa · TkA02G047890|TK1151|PROTEIN

MEAFLEQIPHLKTFKLEQMNSITGNFDNNKVIGEGGFGKVYAGVLSDSEGQITVALKRLSKNSGQGNPEFLKEILMLSHYTHNNLIYLVGFCDEDNEKILVYEHAYHGSLDTHLSSMTLTWTQRLKICIGAARGLAYLHDPQGTQQRVIHRDIKSSNILIDENWIAKISDMGLSKIGPANQSQSFLATNAAGTPLLVNSWKKSYEKNNLDRIIFHALKQCMDMRSREIFSETAYQCLEISRAQRPKMSQVVEKLELALQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G047890`
TK1151 ID	TkA02G047890
OH-1004 ID	LXL04_017356
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.300
Protein coverage (%)	TK1151 99.003 / OH-1004 39.583 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G047890

Location Chr02:12444655-12445956 (+)

Description Similar to At5g38990: Probable receptor-like protein kinase At5g38990

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017356 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G46290

ath:AT3G51550

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · TkA02G047890 · TK1151

Cell membrane0.406

Rank 2 · TkA02G047890 · TK1151

Nucleus0.261

Rank 3 · TkA02G047890 · TK1151

Golgi apparatus0.053

Rank 4 · TkA02G047890 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA02G047890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-195 aa

PF07714PK_Tyr_Ser-Thr29-177 aa

PF17836PglD_N31-80 aa

PF17836PglD_N84-116 aa

PF01636APH140-165 aa

PF07714PK_Tyr_Ser-Thr230-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G047890	`PF00069`	Pkinase	27	195	1.9e-29	103.6
TkA02G047890	`PF07714`	PK_Tyr_Ser-Thr	29	177	1.9e-35	123.1
TkA02G047890	`PF17836`	PglD_N	31	80	0.21	12.9
TkA02G047890	`PF17836`	PglD_N	84	116	0.21	12.9
TkA02G047890	`PF01636`	APH	140	165	0.18	12.3
TkA02G047890	`PF07714`	PK_Tyr_Ser-Thr	230	254	1.9e-35	123.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	47.900%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	47.900%	Swiss-Prot	Medium
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	50.900%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	53.000%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	51.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card