TkA02G046540 | RubberDandelionOmics

Gene overview

TkA02G046540

Reference: TK1151 Chr: Chr02 Coordinates: 11985657-11988108 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1357 bp · TkA02G046540|TK1151|cDNA

GTCTTCTTCTTTCTTCTAATCGACAACTCACCACCTCCGCCTCTATATAAGCAACTGTGTGTCCTCTACAATTTCATTATCATATTGAAAATGGGGAGCTTCAATAAAGAGCGAAAGACGACTGGATGGGCTGCAAGAGATCCTTCTGGACTCCTCTCTCCTTACACCTACACTCTCAGAGAAACAGGGGAAGAAGATGTGTCGATCAAGGTCATTTGCTGCGGTGTTTGTCATACCGATGTTCATCAGATCAAAAATGA...

CDS

Download CDS FASTA

1077 bp · TkA02G046540|TK1151|CDS

ATGGGGAGCTTCAATAAAGAGCGAAAGACGACTGGATGGGCTGCAAGAGATCCTTCTGGACTCCTCTCTCCTTACACCTACACTCTCAGAGAAACAGGGGAAGAAGATGTGTCGATCAAGGTCATTTGCTGCGGTGTTTGTCATACCGATGTTCATCAGATCAAAAATGATCTCGGAATGTCCAATTACCCCATGGTTCCTGGACATGAAGTGGTAGGTGAAGTAGTGGAGGTGGGGTCACATGTTAGTAAATTCAACGT...

Protein

Download Protein FASTA

358 aa · TkA02G046540|TK1151|PROTEIN

MGSFNKERKTTGWAARDPSGLLSPYTYTLRETGEEDVSIKVICCGVCHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSHVSKFNVGDTVGVGLLVGCCNTCRPCEAEVEQYCNKKIWSYNDVYTDGKPTHGGFSNSMVVHQKFVVKIPEGLSPEQAAPLLCAGVTVYSPLSHYGLKKSGLRGAIVGLGGVGHMGVLIAKAMGHHVTVISSSNKKRDEALNVLGADEYLVSSDTTMVQAASDSFDYIIDTVPVNHPLDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G046540`
TK1151 ID	TkA02G046540
OH-1004 ID	LXL04_038447
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.300
Protein coverage (%)	TK1151 100.000 / OH-1004 92.031 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G046540`
Location	Chr02:11985657-11988108 (-)
Description	Similar to CAD1: Probable cinnamyl alcohol dehydrogenase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038447` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009809 lignin biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function
KEGG gene cross-reference	cann:107840223 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.773

Rank 1 · TkA02G046540 · TK1151

Nucleus0.346

Rank 2 · TkA02G046540 · TK1151

Mitochondrion0.077

Rank 3 · TkA02G046540 · TK1151

Peroxisome0.065

Rank 4 · TkA02G046540 · TK1151

Cell membrane0.045

Rank 5 · TkA02G046540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N33-151 aa

PF01262AlaDh_PNT_C98-118 aa

PF028262-Hacid_dh_C176-239 aa

PF01262AlaDh_PNT_C185-254 aa

PF16912Glu_dehyd_C185-278 aa

PF00107ADH_zinc_N191-314 aa

PF13602ADH_zinc_N_2224-342 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G046540	`PF08240`	ADH_N	33	151	1.6e-25	90.1
TkA02G046540	`PF01262`	AlaDh_PNT_C	98	118	0.0052	17.0
TkA02G046540	`PF02826`	2-Hacid_dh_C	176	239	0.0042	17.2
TkA02G046540	`PF01262`	AlaDh_PNT_C	185	254	0.0052	17.0
TkA02G046540	`PF16912`	Glu_dehyd_C	185	278	0.066	13.4
TkA02G046540	`PF00107`	ADH_zinc_N	191	314	1.3e-23	84.0
TkA02G046540	`PF13602`	ADH_zinc_N_2	224	342	6.6e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card