TkA02G044500 | RubberDandelionOmics

Gene overview

TkA02G044500

Reference: TK1151 Chr: Chr02 Coordinates: 11480961-11481881 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · TkA02G044500|TK1151|cDNA

ATGTATTACAGAATGGATGTTGACAAGTGTGCTGGTGTTTTGCTCTATTTGATGATGAAATTGGCAGTTGAGAATTCAAATAAGTCTGGGAATGATTTGGTGAAGGAAACGTATAATGTGATTTCAAAATGGGGGGGATTGGTGAAGCCGTTTTCGCGAGGTGTTGATGGGAAAGTCCAAGTGATATTGAAGCTTGAAGAAATGTGTTTGGCGTCTATGAGCCAGTATGCACCCTTGTTTTTGGCTACACAGAAGGAACA...

CDS

Download CDS FASTA

555 bp · TkA02G044500|TK1151|CDS

ATGTATTACAGAATGGATGTTGACAAGTGTGCTGGTGTTTTGCTCTATTTGATGATGAAATTGGCAGTTGAGAATTCAAATAAGTCTGGGAATGATTTGGTGAAGGAAACGTATAATGTGATTTCAAAATGGGGGGGATTGGTGAAGCCGTTTTCGCGAGGTGTTGATGGGAAAGTCCAAGTGATATTGAAGCTTGAAGAAATGTGTTTGGCGTCTATGAGCCAGTATGCACCCTTGTTTTTGGCTACACAGAAGGAACA...

Protein

Download Protein FASTA

184 aa · TkA02G044500|TK1151|PROTEIN

MYYRMDVDKCAGVLLYLMMKLAVENSNKSGNDLVKETYNVISKWGGLVKPFSRGVDGKVQVILKLEEMCLASMSQYAPLFLATQKEHDKVFVKQSQKFIQWLKESSEEKYRDFQETDLKRLNEGGVQELISRGSMKEVYNVYQYVQDGSCNGLQHYAALGRDNLGAAAVNLVQGVKPADVYSGI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G044500`
TK1151 ID	TkA02G044500
OH-1004 ID	LXL04_033693
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 71.196 / OH-1004 33.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G044500`
Location	Chr02:11480961-11481881 (-)
Description	Similar to tif225: Probable translation initiation factor eIF-2B subunit epsilon (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033693` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002183 cytoplasmic translational initiation Biological Process GO:0006413 translational initiation Biological Process GO:0009408 response to heat Biological Process GO:0009749 response to glucose Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0043434 response to peptide hormone Biological Process GO:0045727 positive regulation of translation Biological Process GO:0045948 positive regulation of translational initiation Biological Process GO:0050852 T cell receptor signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ddi:DDB_G0283163 hsa:8893 ocu:100009393 rno:192234 spo:2542017 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · TkA02G044500 · TK1151

Nucleus0.335

Rank 2 · TkA02G044500 · TK1151

Mitochondrion0.150

Rank 3 · TkA02G044500 · TK1151

Cell membrane0.080

Rank 4 · TkA02G044500 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA02G044500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02020W286-109 aa

PF00940RNA_pol92-117 aa

PF00940RNA_pol146-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G044500	`PF02020`	W2	86	109	0.0041	17.9
TkA02G044500	`PF00940`	RNA_pol	92	117	1.9e-17	64.0
TkA02G044500	`PF00940`	RNA_pol	146	184	1.9e-17	64.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card