TkA02G032740 | RubberDandelionOmics

Gene overview

TkA02G032740

Reference: TK1151 Chr: Chr02 Coordinates: 7926672-7927461 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

701 bp · TkA02G032740|TK1151|cDNA

TCTCCACTGTCCTTCACTACCTTAGCTTTCGCTATTCACAAATCTGAAGTTAAGAAATGTCGAACAAACTGGTCCTACTGAGTTTTGTAGCTCTAACTTTTAGCTACCTTGCCATAGCCTACGAGCCTAGCCCCCTCCAAGATTTTTGTGTAGCCGATCCCAACTCCGCAGTGAAAGTAAATGGAGTGACATGCAAGAACCCGATGCAAGTTCAAGCAGAGGATTTCTTCTTTAGTGGGCTACACCTTAGGGGTAACACA...

CDS

Download CDS FASTA

645 bp · TkA02G032740|TK1151|CDS

ATGTCGAACAAACTGGTCCTACTGAGTTTTGTAGCTCTAACTTTTAGCTACCTTGCCATAGCCTACGAGCCTAGCCCCCTCCAAGATTTTTGTGTAGCCGATCCCAACTCCGCAGTGAAAGTAAATGGAGTGACATGCAAGAACCCGATGCAAGTTCAAGCAGAGGATTTCTTCTTTAGTGGGCTACACCTTAGGGGTAACACATCGAACCAATTAGGGTCAAAGGTGACCCCAGTATTTGCGACACAATTACCAGGGCT...

Protein

Download Protein FASTA

215 aa · TkA02G032740|TK1151|PROTEIN

MSNKLVLLSFVALTFSYLAIAYEPSPLQDFCVADPNSAVKVNGVTCKNPMQVQAEDFFFSGLHLRGNTSNQLGSKVTPVFATQLPGLNTLGISMVRIDYAPWGLNPPHTHPRATEILTVIEGTLQVGFVTSNPNNRFVTKVLQKGDVFVFPVGLVHFQRNVGNGYAVVIAALSSQNPGAITIGNAVFGGNPAIPADILARAFQVDKSVVDQLQGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G032740`
TK1151 ID	TkA02G032740
OH-1004 ID	LXL04_027886
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.200
Protein coverage (%)	TK1151 95.349 / OH-1004 13.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G032740

Location Chr02:7926672-7927461 (-)

Description Similar to Os02g0491600: Putative germin-like protein 2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39160`	May play a role in plant defense.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0491700`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491800`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491600`	May play a role in plant defense.	No verified direct reference in this release
`Os08g0189100`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027886 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048046 apoplast Cellular Component

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0491600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.760

Rank 1 · TkA02G032740 · TK1151

Lysosome / Vacuole0.077

Rank 2 · TkA02G032740 · TK1151

Cytoplasm0.060

Rank 3 · TkA02G032740 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA02G032740 · TK1151

Cell membrane0.041

Rank 5 · TkA02G032740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_163-209 aa

PF07883Cupin_297-169 aa

PF19480DUF6016106-129 aa

PF05899Cupin_3113-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G032740	`PF00190`	Cupin_1	63	209	4.7e-49	166.5
TkA02G032740	`PF07883`	Cupin_2	97	169	3.5e-09	36.9
TkA02G032740	`PF19480`	DUF6016	106	129	0.23	11.8
TkA02G032740	`PF05899`	Cupin_3	113	154	0.26	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92999`	Arabidopsis thaliana	sp\|P92999\|GL118_ARATH Germin-like protein subfamily 1 member 18	62.500%	Swiss-Prot	High
`Q6K5P9`	Oryza sativa subsp. japonica	sp\|Q6K5P9\|GL22_ORYSJ Putative germin-like protein 2-2	63.800%	Swiss-Prot	High
`Q6K5P8`	Oryza sativa subsp. japonica	sp\|Q6K5P8\|GL23_ORYSJ Putative germin-like protein 2-3	69.400%	Swiss-Prot	High
`Q6K5Q0`	Oryza sativa subsp. japonica	sp\|Q6K5Q0\|GL21_ORYSJ Putative germin-like protein 2-1	63.100%	Swiss-Prot	High
`Q6YZA9`	Oryza sativa subsp. japonica	sp\|Q6YZA9\|GL82_ORYSJ Germin-like protein 8-2	66.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card