TkA02G032430 | RubberDandelionOmics

Gene overview

TkA02G032430

Reference: TK1151 Chr: Chr02 Coordinates: 7854650-7856518 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1309 bp · TkA02G032430|TK1151|cDNA

AAAAACAGCTGTAATCCATGAAGGTTTAAATGATTTTCCTATATATATCTATAGGCAAGGTGTATAAGGCTTAAACCATATCAAAATTGTCCATCACATATCCATTATAAGGGAGGAAAAGATGGATATGCAAAATGACAAGCAATCTATAGACTTGCTTCATGCTCAAGCTCACATATGGAACCACACTTTCAGCTTTATAAGGTCCATGTCACTCAAATGTGCTATTGAGCTACAAATACCCGATATCATTGATCGCC...

CDS

Download CDS FASTA

1077 bp · TkA02G032430|TK1151|CDS

ATGGATATGCAAAATGACAAGCAATCTATAGACTTGCTTCATGCTCAAGCTCACATATGGAACCACACTTTCAGCTTTATAAGGTCCATGTCACTCAAATGTGCTATTGAGCTACAAATACCCGATATCATTGATCGCCATGGTGCACCAATGTTGCTCTCTGAATTAGTAGAAGCACTCTCCATCAACAAGGAGAGAACCAATTATGTCTATCGACTTATGCGCATCCTTATTCAATCCGGTTTCTTTGTGACACAAAC...

Protein

Download Protein FASTA

358 aa · TkA02G032430|TK1151|PROTEIN

MDMQNDKQSIDLLHAQAHIWNHTFSFIRSMSLKCAIELQIPDIIDRHGAPMLLSELVEALSINKERTNYVYRLMRILIQSGFFVTQTISNGKEEKEAYLLAPVSRSLLNQEPLSTSPFVLGMLDPGLMEPWQHMSKWFQNDDVNPFYTTHGMMFWVFAGQDSKHNQFFNEAMASDARLVTSVMLRHYGDGFKKLNSVVDVGGGTGTVAKAIADAFPNISCICFDLPHVLDGLNGSNNLSYVCGDMFEAIPKADAVLLKWI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G032430`
TK1151 ID	TkA02G032430
OH-1004 ID	LXL04_017549
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G032430`
Location	Chr02:7854650-7856518 (-)
Description	Similar to ROMT: Trans-resveratrol di-O-methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017549` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009611 response to wounding Biological Process GO:0009699 phenylpropanoid biosynthetic process Biological Process GO:0009717 isoflavonoid biosynthetic process Biological Process GO:0009812 flavonoid metabolic process Biological Process GO:0032259 methylation Biological Process GO:0008171 O-methyltransferase activity Molecular Function GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0030761 8-hydroxyquercitin 8-O-methyltransferase activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0102303 resveratrol 3,5-O-dimethyltransferase activity Molecular Function
KEGG gene cross-reference	ag:ALG05119 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.836

Rank 1 · TkA02G032430 · TK1151

Nucleus0.319

Rank 2 · TkA02G032430 · TK1151

Endoplasmic reticulum0.045

Rank 3 · TkA02G032430 · TK1151

Peroxisome0.042

Rank 4 · TkA02G032430 · TK1151

Mitochondrion0.036

Rank 5 · TkA02G032430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08100Dimerisation20-109 aa

PF23159WHD_Rok39-75 aa

PF08241Methyltransf_1164-84 aa

PF00891Methyltransf_2131-339 aa

PF13489Methyltransf_23191-233 aa

PF05175MTS193-224 aa

PF13649Methyltransf_25197-279 aa

PF08241Methyltransf_11198-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G032430	`PF08100`	Dimerisation	20	109	1.8e-17	63.8
TkA02G032430	`PF23159`	WHD_Rok	39	75	0.3	11.8
TkA02G032430	`PF08241`	Methyltransf_11	64	84	0.0031	18.8
TkA02G032430	`PF00891`	Methyltransf_2	131	339	1.7e-56	191.6
TkA02G032430	`PF13489`	Methyltransf_23	191	233	0.0097	16.3
TkA02G032430	`PF05175`	MTS	193	224	0.25	11.6
TkA02G032430	`PF13649`	Methyltransf_25	197	279	3.1e-05	25.3
TkA02G032430	`PF08241`	Methyltransf_11	198	276	0.0031	18.8
TkA02G032430	`PF08242`	Methyltransf_12	198	278	0.0097	17.3
TkA02G032430	`PF05891`	Methyltransf_PK	247	296	0.033	14.4
TkA02G032430	`PF23159`	WHD_Rok	268	282	0.3	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card