TkA02G027200 | RubberDandelionOmics

Gene overview

TkA02G027200

Reference: TK1151 Chr: Chr02 Coordinates: 6581898-6584108 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

976 bp · TkA02G027200|TK1151|cDNA

TCACCAGCCACCTGTATCGGCCTGAGCATTTGCCCGTTCAACAATTTCCAATTTCCAGGGAGCGGAGAGAGAGAAAAAGATACCACGAAATCGAGTTTTGAGAAAGCGACGGTAATTGGGTAGGAAGAAAACCTCCGAAACAAATTGGTGGAATGTCCGATGCTCTCTTCATCGCCGCCGACCTCGGTTTCCCTGTTTGTTCTCCTCCATCCAAGTCAAAGTCAAAGTCAAAATCATTTAGCAATGATGAAAAGTGTGAG...

CDS

Download CDS FASTA

750 bp · TkA02G027200|TK1151|CDS

ATGGCGTCGATGCAGGAAAGCGACGGTAATTGGGTAGGAAGAAAACCTCCGAAACAAATTGGTGGAATGTCCGATGCTCTCTTCATCGCCGCCGACCTCGGTTTCCCTGTTTGTTCTCCTCCATCCAAGTCAAAGTCAAAGTCAAAATCATTTAGCAATGATGAAAAGTGTGAGGAGTTTGTAAGACTATTGCGTGAACTTTCCATGGTACAAAAAAAAGTTGCAGATCTACACGTGGAACTTCAAGGTCGTAAGGAAGA...

Protein

Download Protein FASTA

249 aa · TkA02G027200|TK1151|PROTEIN

MASMQESDGNWVGRKPPKQIGGMSDALFIAADLGFPVCSPPSKSKSKSKSFSNDEKCEEFVRLLRELSMVQKKVADLHVELQGRKEDINVAHLTHVSEMEKKMETLARITRILKGVIQNKDRILTRLHQPYPENCIPIEAEYQKQFTELLMMAASDYGTLTASVSDLYWAESFKEPPSVWRDMLRPIRVALVSCTRYFEAMTAMKECFATLQKMRSGPSQSSSKYVSHRTSPTESECVTPRSSANDLDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G027200`
TK1151 ID	TkA02G027200
OH-1004 ID	LXL04_001861
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	66.000
Protein coverage (%)	TK1151 96.386 / OH-1004 84.507 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G027200

Location Chr02:6581898-6584108 (-)

Description Similar to AUG2: AUGMIN subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32980`	Contributes to the assembly of the acentrosomal spindle and phragmoplast microtubule arrays as part of the augmin complex.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001861 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007020 microtubule nucleation Biological Process

GO:0031023 microtubule organizing center organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:1990498 mitotic spindle microtubule Cellular Component

KEGG gene cross-reference

ath:AT2G32980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · TkA02G027200 · TK1151

Nucleus0.377

Rank 2 · TkA02G027200 · TK1151

Cell membrane0.092

Rank 3 · TkA02G027200 · TK1151

Mitochondrion0.068

Rank 4 · TkA02G027200 · TK1151

Golgi apparatus0.041

Rank 5 · TkA02G027200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15003HAUS221-210 aa

PF19697Atg11_middle58-88 aa

PF13270CCDC2865-107 aa

PF05701WEMBL70-105 aa

PF10167BORCS870-123 aa

PF10167BORCS8197-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G027200	`PF15003`	HAUS2	21	210	4.2e-69	232.8
TkA02G027200	`PF19697`	Atg11_middle	58	88	0.029	15.3
TkA02G027200	`PF13270`	CCDC28	65	107	0.12	13.5
TkA02G027200	`PF05701`	WEMBL	70	105	0.053	13.0
TkA02G027200	`PF10167`	BORCS8	70	123	0.07	13.8
TkA02G027200	`PF10167`	BORCS8	197	222	0.07	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48767`	Arabidopsis thaliana	sp\|O48767\|AUG2_ARATH AUGMIN subunit 2	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card