Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1257 bp · TkA02G022490|TK1151|cDNA
ATGACTTATACAATTACCACTAAAATTATCGTGTTTCTTTACTTAATCTCGATCTCTGAAGCTATACGTAACATAATTTCAATCAAGAATCAAGATGAATTATCCTCACCATCGGTTAACGAGCCCGGCATATGTAGCTTACTGATTGAGACACAAGGCTACAAGTGTGAAGAACACAAGGTATCTCTCTGTGCGAATTATATTATAGGTGACAAAGTGACAACAAAAGATGGTTATATACTTAGCATGCAACGGATTCC...
1257 bp · TkA02G022490|TK1151|CDS
ATGACTTATACAATTACCACTAAAATTATCGTGTTTCTTTACTTAATCTCGATCTCTGAAGCTATACGTAACATAATTTCAATCAAGAATCAAGATGAATTATCCTCACCATCGGTTAACGAGCCCGGCATATGTAGCTTACTGATTGAGACACAAGGCTACAAGTGTGAAGAACACAAGGTATCTCTCTGTGCGAATTATATTATAGGTGACAAAGTGACAACAAAAGATGGTTATATACTTAGCATGCAACGGATTCC...
Protein
Download Protein FASTA418 aa · TkA02G022490|TK1151|PROTEIN
MTYTITTKIIVFLYLISISEAIRNIISIKNQDELSSPSVNEPGICSLLIETQGYKCEEHKVSLCANYIIGDKVTTKDGYILSMQRIPTGRGGEKSNKPPVLLQHGVLMDGGTWVLNSPDESLGFILADNGFDVWIANTRGTNFSRGHTSLNPSDPAYWEWSWDELVAFDLPASTQFVHDQTGQKMHYVGHSLGTLIAFSAFSKDQTLNMLRSAVLLSPIAYLGQMSSTLARAGADVFLGEALYWLGLHEFAPRGKAVADL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G022490 |
|---|---|
| TK1151 ID | TkA02G022490 |
| OH-1004 ID | LXL04_017590 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G022490 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:5337174-5340321 (-) | |||||||||
| Description | Similar to LIP2: Triacylglycerol lipase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002213 defense response to insect Biological Process GO:0006108 malate metabolic process Biological Process GO:0006629 lipid metabolic process Biological Process GO:0009739 response to gibberellin Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0010029 regulation of seed germination Biological Process GO:0016042 lipid catabolic process Biological Process GO:0046486 glycerolipid metabolic process Biological Process GO:2000033 regulation of seed dormancy process Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005739 mitochondrion Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G15230 ath:AT5G14180 hsa:643414 mmu:240633 rno:50682 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04083Abhydro_lipase49-116 aaPF00561Abhydrolase_198-221 aaPF12697Abhydrolase_6101-245 aaPF12146Hydrolase_4122-244 aaPF01738DLH169-207 aaPF10230LIDHydrolase169-221 aaPF24856AraA_central256-319 aaPF00561Abhydrolase_1300-376 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G022490 | PF04083 | Abhydro_lipase | 49 | 116 | 3.9e-19 | 68.7 |
| TkA02G022490 | PF00561 | Abhydrolase_1 | 98 | 221 | 5.5e-11 | 43.3 |
| TkA02G022490 | PF12697 | Abhydrolase_6 | 101 | 245 | 0.0024 | 19.2 |
| TkA02G022490 | PF12146 | Hydrolase_4 | 122 | 244 | 6e-08 | 33.0 |
| TkA02G022490 | PF01738 | DLH | 169 | 207 | 0.053 | 13.8 |
| TkA02G022490 | PF10230 | LIDHydrolase | 169 | 221 | 0.24 | 11.8 |
| TkA02G022490 | PF24856 | AraA_central | 256 | 319 | 0.28 | 12.3 |
| TkA02G022490 | PF00561 | Abhydrolase_1 | 300 | 376 | 5.5e-11 | 43.3 |
| TkA02G022490 | PF01738 | DLH | 333 | 409 | 0.053 | 13.8 |
| TkA02G022490 | PF12146 | Hydrolase_4 | 351 | 381 | 6e-08 | 33.0 |
| TkA02G022490 | PF12697 | Abhydrolase_6 | 360 | 378 | 0.0024 | 19.2 |
| TkA02G022490 | PF24856 | AraA_central | 365 | 396 | 0.28 | 12.3 |
| TkA02G022490 | PF10304 | RTP1_C2 | 366 | 387 | 0.22 | 11.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.