TkA02G020150 | RubberDandelionOmics

Gene overview

TkA02G020150

Reference: TK1151 Chr: Chr02 Coordinates: 4724927-4730890 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4081 bp · TkA02G020150|TK1151|cDNA

CTGTTTTCGGTTTAAGTTCGTGATTTGAAACAACTTCAAATATAGGCCGCACACGGAAACTCTCAAAATTTCTCCAAACTTTTGCCACCATTTCTCCAAAGGGTCCCTTCTCTAAAAGACTAAAACCCTAAACCTCTTCATTCAAATCAATTGATTCAATTAGTTTCGTTTTCTCCACTCTTCTTCAGTAATGTTTTCACCAGGGACCAAGAAATCCAACTTCAGTTCTAGAAAGGATCGAACAGTTCGTGAGCATCCGC...

CDS

Download CDS FASTA

3741 bp · TkA02G020150|TK1151|CDS

ATGTTTTCACCAGGGACCAAGAAATCCAACTTCAGTTCTAGAAAGGATCGAACAGTTCGTGAGCATCCGCCTCATGTTGGAAATGGTTCTCCGGTCACGCCTCTTACTGATAATAGAAATTCGGTGACGGAAAATACTATCCCTGACAGACCGAATACCGGCACTCCCGCTCCCTGGACATCTCGGTTATCTGTCCTTGCTAGAATCCCAAATGTGAAGAAAAGTGACAAACCGGATGATGTGGACCCCATTCAGCCTGT...

Protein

Download Protein FASTA

1246 aa · TkA02G020150|TK1151|PROTEIN

MFSPGTKKSNFSSRKDRTVREHPPHVGNGSPVTPLTDNRNSVTENTIPDRPNTGTPAPWTSRLSVLARIPNVKKSDKPDDVDPIQPVYVGEVPQAVRDEQAKMLQKRSSGDTGIYGGMDKGTSLAWIICGNKLFIWSYLSPAASRNCIILELPSNILEDRDPNKNFTTSWLLCFLDFDNTQMVIHQQRTSTGVLLCNRKTRTFIYYPNIHSSIPSVTYTDPSKSNSFNSLIASVIPDNQNSCIALACTSQGQLCKFICTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G020150`
TK1151 ID	TkA02G020150
OH-1004 ID	LXL04_017635
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G020150

Location Chr02:4724927-4730890 (-)

Description Similar to NUP133: Nuclear pore complex protein NUP133

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05120`	Nuclear pore complex protein NUP133.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017635 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000972 transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006999 nuclear pore organization Biological Process

GO:0016973 poly(A)+ mRNA export from nucleus Biological Process

GO:0048731 system development Biological Process

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005643 nuclear pore Cellular Component

GO:0031080 nuclear pore outer ring Cellular Component

KEGG gene cross-reference

ath:AT2G05120

dre:406852

mmu:234865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.708

Rank 1 · TkA02G020150 · TK1151

Cytoplasm0.348

Rank 2 · TkA02G020150 · TK1151

Cell membrane0.036

Rank 3 · TkA02G020150 · TK1151

Mitochondrion0.034

Rank 4 · TkA02G020150 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA02G020150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08801Nucleoporin_N89-501 aa

PF03177Nucleoporin_C955-1083 aa

PF03177Nucleoporin_C1132-1166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G020150	`PF08801`	Nucleoporin_N	89	501	3e-25	89.6
TkA02G020150	`PF03177`	Nucleoporin_C	955	1083	3.8e-08	33.3
TkA02G020150	`PF03177`	Nucleoporin_C	1132	1166	3.8e-08	33.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IGA5`	Arabidopsis thaliana	sp\|F4IGA5\|NU133_ARATH Nuclear pore complex protein NUP133	50.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card