TkA02G016790 | RubberDandelionOmics

Gene overview

TkA02G016790

Reference: TK1151 Chr: Chr02 Coordinates: 3917265-3919184 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1805 bp · TkA02G016790|TK1151|cDNA

CAGATCTGAAGAAGAGAGTGTTGATGAATGTGTAATTCGATTACACTACAAATGTATACTTAGAGAGAAAAATGATGCTTGGCCGGGGTTTACCATCCCGATCTGGTAGCTTCCGGCCGGAAAATCTAGGTCAAAACGCCTTAGCTTTAATCGGAAACGTGTTTTTCACGTTTTTTGTAATCGGTGTTTTAGTCTTCACGATTATCGCCGCTACTTATGAACCCGAAGATCCTCTGTTTCATCCTTCAACTAAGATCACA...

CDS

Download CDS FASTA

1722 bp · TkA02G016790|TK1151|CDS

ATGATGCTTGGCCGGGGTTTACCATCCCGATCTGGTAGCTTCCGGCCGGAAAATCTAGGTCAAAACGCCTTAGCTTTAATCGGAAACGTGTTTTTCACGTTTTTTGTAATCGGTGTTTTAGTCTTCACGATTATCGCCGCTACTTATGAACCCGAAGATCCTCTGTTTCATCCTTCAACTAAGATCACAAGCTTCCTCACTTCCACTTCCAATGCGACGTTTGTATCCGATAGCACCGTCGTGAAAACCGGCGAGGACTT...

Protein

Download Protein FASTA

573 aa · TkA02G016790|TK1151|PROTEIN

MMLGRGLPSRSGSFRPENLGQNALALIGNVFFTFFVIGVLVFTIIAATYEPEDPLFHPSTKITSFLTSTSNATFVSDSTVVKTGEDFMTANITAFGESINASDVISAVKWDAEGETEVKEALDCSGEIDKPIDCTDPEVFHLMMSAAIDQFKDIHFYRFGKSVRGMNDSSCHMAWRFRPKEGKTASLYKDYRSFVISRSVNCSLSVVSIGDYHSGGNARKRKKHQTPGFEKSPTGEDNKNKNIQVVGETVNDSLPVVESE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G016790`
TK1151 ID	TkA02G016790
OH-1004 ID	LXL04_014451
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	21.300
Protein coverage (%)	TK1151 49.738 / OH-1004 75.694 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G016790`
Location	Chr02:3917265-3919184 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014451` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.678

Rank 1 · TkA02G016790 · TK1151

Endoplasmic reticulum0.146

Rank 2 · TkA02G016790 · TK1151

Cell membrane0.099

Rank 3 · TkA02G016790 · TK1151

Cytoplasm0.096

Rank 4 · TkA02G016790 · TK1151

Extracellular0.058

Rank 5 · TkA02G016790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23269DUF7074129-214 aa

PF28183T4SS_Ceg9132-181 aa

PF23272DUF7075263-553 aa

PF10250O-FucT287-361 aa

PF28183T4SS_Ceg9288-309 aa

PF23269DUF7074322-332 aa

PF23269DUF7074354-369 aa

PF10250O-FucT451-504 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G016790	`PF23269`	DUF7074	129	214	9.5e-38	129.1
TkA02G016790	`PF28183`	T4SS_Ceg9	132	181	0.11	13.0
TkA02G016790	`PF23272`	DUF7075	263	553	3.3e-91	306.1
TkA02G016790	`PF10250`	O-FucT	287	361	8e-06	26.5
TkA02G016790	`PF28183`	T4SS_Ceg9	288	309	0.11	13.0
TkA02G016790	`PF23269`	DUF7074	322	332	9.5e-38	129.1
TkA02G016790	`PF23269`	DUF7074	354	369	9.5e-38	129.1
TkA02G016790	`PF10250`	O-FucT	451	504	8e-06	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card