RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G012720
Reference: TK1151 Chr: Chr02 Coordinates: 2891992-2895204 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2361 bp · TkA02G012720|TK1151|cDNA

AGAAAGATGAGTCGAACTTTTCTTTGAACCATCAAGCTTTTCCTTAAGATCTCAAATTGTATTTTTACCAAGCATCAAGCTTTTCCTTGAAGCTTCCAAACTTTTCTGTGAAGCTCCTCCCACTTGGTTTCCAATTTTATTTCCACCATCAAAATGATGCATCTCATAAATAAGTTTGAACACCTGAAGATACACTTGGAAGCTTTAAAATTAGCAACAAACAACTTTTCTGCTGAAAATTGTATCGGTAGAGGAGGTTT...

CDS

Download CDS FASTA

1989 bp · TkA02G012720|TK1151|CDS

ATGATGCATCTCATAAATAAGTTTGAACACCTGAAGATACACTTGGAAGCTTTAAAATTAGCAACAAACAACTTTTCTGCTGAAAATTGTATCGGTAGAGGAGGTTTTGGAAAAGTATACAAGGGAGAGCTTGTTCATTCCAAAGAGAAAGTAGTTGTTGCCTTAAAGCGATTAGACCCAAGATTTGGGCAAGGAAATCCGGAGTTTTGGATGGAGATCCTTATGCTTTCTCTTCACAAACACGAAAACATTATTTCTTT...

Protein

Download Protein FASTA

662 aa · TkA02G012720|TK1151|PROTEIN

MMHLINKFEHLKIHLEALKLATNNFSAENCIGRGGFGKVYKGELVHSKEKVVVALKRLDPRFGQGNPEFWMEILMLSLHKHENIISLLGFCDENNEKILVYEYASRRSLDAYLDHDDLTWIRRLKICIGAARGLAYLHNPGETQQRVLHRDIKSSNILLDENWNAKIADLGLSKFGPANQRYTFLVTNTVGTLGYCDPVYIETGLLTKESDVYSFGVVLFEVLCGRLSINNNNGSTESLIGLVRQYYPQNKISDIIYSNM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G012720
TK1151 IDTkA02G012720
OH-1004 IDLXL04_017665
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.300
Protein coverage (%)TK1151 99.094 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G012720
LocationChr02:2891992-2895204 (+)
DescriptionSimilar to PTI1: Pto-interacting protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g17410 May phosphorylate ABA receptors and participate in ABA signaling during dehydration.
CARK1 mediates ABA signaling by phosphorylation of ABA receptors.2018 · DOI: 10.1038/s41421-018-0029-y
The Expression of CARK1 or RCAR11 Driven by Synthetic Promoters Increases Drought Tolerance in Arabidopsis thaliana .2018 · DOI: 10.3390/ijms19071945
Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
At1g48210 Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses. No verified direct reference in this release
At2g47060 Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (Probable).
The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x
Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
At3g62220 May phosphorylate ABA receptors and participate in ABA signaling during dehydration.
Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017665 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:1902584 positive regulation of response to water deprivation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0000287 magnesium ion binding Molecular Function
KEGG gene cross-reference
ath:AT1G48210
ath:AT3G17410
sly:544006
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.567
Rank 1 · TkA02G012720 · TK1151
Cytoplasm0.346
Rank 2 · TkA02G012720 · TK1151
Nucleus0.228
Rank 3 · TkA02G012720 · TK1151
Endoplasmic reticulum0.041
Rank 4 · TkA02G012720 · TK1151
Golgi apparatus0.037
Rank 5 · TkA02G012720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-294 aa
PF07714PK_Tyr_Ser-Thr28-296 aa
PF03109ABC129-57 aa
PF21477FERM_C_FAK1119-148 aa
PF01636APH138-177 aa
PF03109ABC1143-184 aa
PF17667Pkinase_fungal144-173 aa
PF00069Pkinase371-646 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G012720PF00069Pkinase272944.2e-79266.4
TkA02G012720PF07714PK_Tyr_Ser-Thr282962.3e-87293.3
TkA02G012720PF03109ABC129570.05613.3
TkA02G012720PF21477FERM_C_FAK11191480.01316.8
TkA02G012720PF01636APH1381770.0009219.7
TkA02G012720PF03109ABC11431840.05613.3
TkA02G012720PF17667Pkinase_fungal1441730.0008218.9
TkA02G012720PF00069Pkinase3716464.2e-79266.4
TkA02G012720PF07714PK_Tyr_Ser-Thr3746482.3e-87293.3
TkA02G012720PF03109ABC13814060.05613.3
TkA02G012720PF21477FERM_C_FAK14634920.01316.8
TkA02G012720PF17667Pkinase_fungal4775230.0008218.9
TkA02G012720PF01636APH4895170.0009219.7
TkA02G012720PF03109ABC14925060.05613.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LUT0Arabidopsis thalianasp|Q9LUT0|CARK1_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 163.400%Swiss-ProtLow
F4HWU0Arabidopsis thalianasp|F4HWU0|CAK11_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 1162.400%Swiss-ProtLow
O80719Arabidopsis thalianasp|O80719|CARK3_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 362.500%Swiss-ProtLow
Q9M1Q2Arabidopsis thalianasp|Q9M1Q2|CARK2_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 261.900%Swiss-ProtLow

JBrowse

View in Genome Browser