TkA02G011740 | RubberDandelionOmics

Gene overview

TkA02G011740

Reference: TK1151 Chr: Chr02 Coordinates: 2603825-2606799 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1980 bp · TkA02G011740|TK1151|cDNA

ACGAAACCAAAATCAATTCATTTTTCAATTGTTTGAGTTTTCTAACCTAGCACACTCCTGTCGGCGTCGACACTCTCGTCTCCCGACCTCCCGCCTCATCACCATCACCAGCTCGTCTGCTCCCCACCGGCCACCTGCTCCGCCATCGCCTCCCTGCTCCGACGTCCCCTCCCTGTTCCGCACCTCTTCCTCGACGCACGACGACAGGCAGCACCGCAGCAGCGCTCACGACCTGAAGTCCTGAACTTCTCCGCACCTCC...

CDS

Download CDS FASTA

498 bp · TkA02G011740|TK1151|CDS

ATGGAAGAAACCAAGAACCAAGGATCGGGTCCATTGGTGTGCAAAATGGGACGTGATATTGAATCACCATATTACCATCCACTCGAGGCATGCATAGGTGGCACTCACACCCACCGATGGATCCCAATTGAGAAAAGACCAATTTGGCCCTCTAGATCCCTCTTAAACTCCAAGGAACTCGCCATCCATGGTGTGATTCCTGATGACTTATTTGAAGACGAAATGAATTGGAAATCGGGAGTGAGAAACTATTGGTCTCT...

Protein

Download Protein FASTA

165 aa · TkA02G011740|TK1151|PROTEIN

MEETKNQGSGPLVCKMGRDIESPYYHPLEACIGGTHTHRWIPIEKRPIWPSRSLLNSKELAIHGVIPDDLFEDEMNWKSGVRNYWSLLSPLIFSDHPKRPGIEDPTPPYNMVRNVLDMNARFGGFNSALLDARKSVWVMNVVPTTAPINLPLILDRGFLGVLHDR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G011740`
TK1151 ID	TkA02G011740
OH-1004 ID	LXL04_030121
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 97.576 / OH-1004 21.845 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G011740

Location Chr02:2603825-2606799 (-)

Description Similar to QUA2: Probable pectin methyltransferase QUA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78240`	May be involved in the synthesis of homogalacturonan.	Homogalacturonan synthesis in Arabidopsis thaliana requires a Golgi-localized protein with a putative methyltransferase domain.2007 · DOI: 10.1111/j.1365-313x.2007.03086.x The TUMOROUS SHOOT DEVELOPMENT2 gene of Arabidopsis encoding a putative methyltransferase is required for cell adhesion and co-ordinated plant development.2007 · DOI: 10.1111/j.1365-313x.2007.03123.x The OSU1/QUA2/TSD2-encoded putative methyltransferase is a critical modulator of carbon and nitrogen nutrient balance response in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0001387
`At1g13860`	Probable methyltransferase PMT4.	No verified direct reference in this release
`At2g03480`	Probable methyltransferase PMT5.	No verified direct reference in this release
`At5g06050`	Probable methyltransferase PMT12.	No verified direct reference in this release
`At2g39750`	Probable methyltransferase PMT11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030121 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007155 cell adhesion Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010289 homogalacturonan biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G04430

ath:AT1G13860

ath:AT1G78240

ath:AT2G03480

ath:AT3G23300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.319

Rank 1 · TkA02G011740 · TK1151

Extracellular0.163

Rank 2 · TkA02G011740 · TK1151

Cell membrane0.120

Rank 3 · TkA02G011740 · TK1151

Nucleus0.081

Rank 4 · TkA02G011740 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA02G011740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_293-164 aa

PF17166DUF5126106-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G011740	`PF03141`	Methyltransf_29	3	164	7.3e-23	81.6
TkA02G011740	`PF17166`	DUF5126	106	143	0.013	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9Q8`	Arabidopsis thaliana	sp\|Q9C9Q8\|PMTT_ARATH Probable pectin methyltransferase QUA2	69.600%	Swiss-Prot	High
`Q8GYW9`	Arabidopsis thaliana	sp\|Q8GYW9\|PMT4_ARATH Probable methyltransferase PMT4	58.400%	Swiss-Prot	High
`Q3EC77`	Arabidopsis thaliana	sp\|Q3EC77\|PMT5_ARATH Probable methyltransferase PMT5	56.500%	Swiss-Prot	High
`Q9FG39`	Arabidopsis thaliana	sp\|Q9FG39\|PMTC_ARATH Probable methyltransferase PMT12	33.700%	Swiss-Prot	Medium
`O22285`	Arabidopsis thaliana	sp\|O22285\|PMTB_ARATH Probable methyltransferase PMT11	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card