TkA01G641640 | RubberDandelionOmics

Gene overview

TkA01G641640

Reference: TK1151 Chr: Chr01 Coordinates: 162380545-162382262 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · TkA01G641640|TK1151|cDNA

CTTCTGAATCATTTCATGAGTGCACTACAATATCATAAAATATCCATGTAAGATAGAATTTGATGATTCAAAAATAAGTAATCACGTTTCACAAACACATAGGGACATATCTCTATGAAAAAAACTCACATTAATGATGTAGAGGTTCTACCTTCAACCCTCACCTAAACTTAAGTTACACTAATGTAAAATGTAAAAATGGAATGGAGTAGTGGAGGATAAAGTCGTCATTTAACTCGTACCCAAGCTGCCAAGCATCC...

CDS

Download CDS FASTA

702 bp · TkA01G641640|TK1151|CDS

ATGGCAGTGGATAGAAGTCAGCTTCTTCTCGTAGGGTTACCTCTCTTTCTCTTCTGTTCCGACGTCTTCAACCTCTTCGCTCCTGCACCTGTCAAACCCGCCGCCCATCACCACCATATTCCGCCCCAACAACCCCAACACTTTCAAACCCCGTCGATCCAACAACCCCTCGATTTCCCCACGCAGAAAGCCAGTGGGTTTGGTGGAGGGATCGGGTTCGGAAACACCGTCCAGATCGACTTCTGCGCCTCATGTTCTTA...

Protein

Download Protein FASTA

233 aa · TkA01G641640|TK1151|PROTEIN

MAVDRSQLLLVGLPLFLFCSDVFNLFAPAPVKPAAHHHHIPPQQPQHFQTPSIQQPLDFPTQKASGFGGGIGFGNTVQIDFCASCSYRGNAVTMKNMLETAYPGLNVVLANYPPPLPKRLLSKVVPVFQFGVIGVVMAGEHIFPRLGFAAPPPWYYSMRANRFGTISSTWLLGNFLQGFLQSSSAFEVSVNGDRVYSKLREKRFPGEIELREIVGKKIANSRLVDDIDSSIWS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G641640`
TK1151 ID	TkA01G641640
OH-1004 ID	LXL04_000017
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G641640

Location Chr01:162380545-162382262 (-)

Description Similar to At3g47300: SelT-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47300`	SelT-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045454 cell redox homeostasis Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0004791 thioredoxin-disulfide reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT3G47300

cel:CELE_C35C5.3

cel:CELE_F28H7.4

dme:Dmel_CG3887

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.460

Rank 1 · TkA01G641640 · TK1151

Plastid0.337

Rank 2 · TkA01G641640 · TK1151

Golgi apparatus0.133

Rank 3 · TkA01G641640 · TK1151

Nucleus0.062

Rank 4 · TkA01G641640 · TK1151

Cytoplasm0.052

Rank 5 · TkA01G641640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10262Rdx76-214 aa

PF10640MCEL_TPase195-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G641640	`PF10262`	Rdx	76	214	3.3e-15	56.7
TkA01G641640	`PF10640`	MCEL_TPase	195	232	0.18	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STZ2`	Arabidopsis thaliana	sp\|Q9STZ2\|SELT_ARATH SelT-like protein	61.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card