TkA01G634630 | RubberDandelionOmics

Gene overview

TkA01G634630

Reference: TK1151 Chr: Chr01 Coordinates: 160549419-160551210 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1215 bp · TkA01G634630|TK1151|cDNA

CACAAACTCTCCGACTGCCGTTGTGATTTCAATTTCAAATTCGATCAATTTATATCCCTCCCATTTCATACTCACGCTCCCACCTTCATTCTGCAACCAGCCATGGCCATGGAAGACAAGTACGAGAAACTGGAGAAGGTAGGCGAAGGCACCTATGGAAAAGTCTACAAAGCCAAAGACAAGCAAACCGGTCAACTCGTCGCCCTCAAGAAAACCCGTCTCGAGATGGACGAGGAAGGCATCCCACCCACCGCCCTCCG...

CDS

Download CDS FASTA

1023 bp · TkA01G634630|TK1151|CDS

CACAAACTCTCCGACTGCCGTTGTGATTTCAATTTCAAATTCGATCAATTTATATCCCTCCCATTTCATACTCACGCTCCCACCTTCATTCTGCAACCAGCCATGGCCATGGAAGACAAGTACGAGAAACTGGAGAAGGTAGGCGAAGGCACCTATGGAAAAGTCTACAAAGCCAAAGACAAGCAAACCGGTCAACTCGTCGCCCTCAAGAAAACCCGTCTCGAGATGGACGAGGAAGGCATCCCACCCACCGCCCTCCG...

Protein

Download Protein FASTA

340 aa · TkA01G634630|TK1151|PROTEIN

HKLSDCRCDFNFKFDQFISLPFHTHAPTFILQPAMAMEDKYEKLEKVGEGTYGKVYKAKDKQTGQLVALKKTRLEMDEEGIPPTALREISLLQMLSNSIYIVRLICVQHIHHNGKPLLYLVFEYLDTDLKKFIDSHRKGPNPSPLPSSQIQSFLFQLCKGVAHCHGHGVLHRDLKPQNLLVDKEKGILKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMSRRQALFPGDSEFQQLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G634630`
TK1151 ID	TkA01G634630
OH-1004 ID	LXL04_010696
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.700
Protein coverage (%)	TK1151 87.353 / OH-1004 88.923 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G634630

Location Chr01:160549419-160551210 (+)

Description Similar to CDC2A: Cell division control protein 2 homolog A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38620`	Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata.	No verified direct reference in this release
`At3g54180`	May control G2/M (mitosis) phase progression.	An Arabidopsis cell cycle -dependent kinase-related gene, CDC2b, plays a role in regulating seedling growth in darkness.1999 · DOI: 10.1105/tpc.11.10.1883
`At1g20930`	Cyclin-dependent kinase B2-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0897000`	Cyclin-dependent kinase B1-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010696 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0007165 signal transduction Biological Process

GO:0010389 regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008353 RNA polymerase II CTD heptapeptide repeat kinase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.618

Rank 1 · TkA01G634630 · TK1151

Cytoplasm0.571

Rank 2 · TkA01G634630 · TK1151

Mitochondrion0.059

Rank 3 · TkA01G634630 · TK1151

Cell membrane0.051

Rank 4 · TkA01G634630 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA01G634630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12330Haspin_kinase12-199 aa

PF03109ABC136-78 aa

PF00069Pkinase41-332 aa

PF07714PK_Tyr_Ser-Thr44-245 aa

PF14531Kinase-like46-72 aa

PF01636APH81-126 aa

PF06293Kdo83-186 aa

PF08966DUF188288-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G634630	`PF12330`	Haspin_kinase	12	199	0.037	13.8
TkA01G634630	`PF03109`	ABC1	36	78	0.00037	20.4
TkA01G634630	`PF00069`	Pkinase	41	332	1.1e-64	219.1
TkA01G634630	`PF07714`	PK_Tyr_Ser-Thr	44	245	2.8e-27	96.4
TkA01G634630	`PF14531`	Kinase-like	46	72	0.22	11.4
TkA01G634630	`PF01636`	APH	81	126	0.055	13.9
TkA01G634630	`PF06293`	Kdo	83	186	0.0032	17.6
TkA01G634630	`PF08966`	DUF1882	88	138	0.22	12.6
TkA01G634630	`PF03109`	ABC1	150	209	0.00037	20.4
TkA01G634630	`PF14531`	Kinase-like	155	192	0.22	11.4
TkA01G634630	`PF01636`	APH	168	186	0.055	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2V419`	Arabidopsis thaliana	sp\|Q2V419\|CKB12_ARATH Cyclin-dependent kinase B1-2	81.900%	Swiss-Prot	High
`P25859`	Arabidopsis thaliana	sp\|P25859\|CKB11_ARATH Cyclin-dependent kinase B1-1	82.500%	Swiss-Prot	High
`Q8LG64`	Arabidopsis thaliana	sp\|Q8LG64\|CKB22_ARATH Cyclin-dependent kinase B2-2	67.200%	Swiss-Prot	High
`Q8L4P8`	Oryza sativa subsp. japonica	sp\|Q8L4P8\|CKB11_ORYSJ Cyclin-dependent kinase B1-1	85.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card