TkA01G628680 | RubberDandelionOmics

Gene overview

TkA01G628680

Reference: TK1151 Chr: Chr01 Coordinates: 158958723-158963213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1420 bp · TkA01G628680|TK1151|cDNA

ACACCCAGTCAAAATTATTTATTCCCGTCACCGGCTTGGCTTCTCACATACGACATCTGCAATGCCCTAGATCTCACAACCGTCGCACCTTCTTCGATCGGAATCCACCACTCGCTGCAACTCCCTCACTCCGTCTACAATGGCTTCATCCATTTGCTCTTCGTTTCGAGCAATTATCCCTCGGTGGACCCACACGAACAAAAACTTCAGATACTGTTTGCTCCTGCACTGCAAAAGGAAGCATTCTTTCGGCTACTCTC...

CDS

Download CDS FASTA

387 bp · TkA01G628680|TK1151|CDS

ATGTTTCTTTTGAAAATGGCGGAAACACTAAGGGATTCTTTTCCATCAACTGACAAATCTTTGACAAATATTTGGTGCATCACCTCAGCTTCTAGAAATTATTTTAGATTCACCTGTTGGAAGCGAGATCCTTCTGATGCAGGTACTGTAGCTGACGCCATTGCAGCTGCAAATACTGCTGCTGAAGTTGCCTTAAGCCTTGTGAAGAAGGATGCAGAGATTCTTATTCCAATATTACCCTTCCTACCCAAACATGAGCT...

Protein

Download Protein FASTA

128 aa · TkA01G628680|TK1151|PROTEIN

MFLLKMAETLRDSFPSTDKSLTNIWCITSASRNYFRFTCWKRDPSDAGTVADAIAAANTAAEVALSLVKKDAEILIPILPFLPKHELLQIFSCFVNLPLDKFQVTDTCNSCFQQRQIFTQQVLAKVLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G628680`
TK1151 ID	TkA01G628680
OH-1004 ID	LXL04_036129
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.600
Protein coverage (%)	TK1151 29.688 / OH-1004 2.844 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G628680`
Location	Chr01:158958723-158963213 (-)
Description	Similar to SYMPK: Symplekin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036129` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0007155 cell adhesion Biological Process GO:0031124 mRNA 3'-end processing Biological Process GO:0032091 negative regulation of protein binding Biological Process GO:0071045 nuclear histone mRNA catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005847 mRNA cleavage and polyadenylation specificity factor complex Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	hsa:8189 mmu:68188 xla:379378 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393

Rank 1 · TkA01G628680 · TK1151

Nucleus0.301

Rank 2 · TkA01G628680 · TK1151

Mitochondrion0.287

Rank 3 · TkA01G628680 · TK1151

Cell membrane0.109

Rank 4 · TkA01G628680 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA01G628680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12295Symplekin_C71-103 aa

PF12295Symplekin_C103-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G628680	`PF12295`	Symplekin_C	71	103	1.4e-06	29.1
TkA01G628680	`PF12295`	Symplekin_C	103	127	1.4e-06	29.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card