TkA01G626880 | RubberDandelionOmics

Gene overview

TkA01G626880

Reference: TK1151 Chr: Chr01 Coordinates: 158232262-158233823 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · TkA01G626880|TK1151|cDNA

ATGTCCACTGGATTCCCACCAAATCCACCACTAAAACTCGAAGAACTCCATCACTGTACCCAAGCTCTCAAGTTTTTCAAGGAGAAACGGACTCACCAGTTATCACTTATTAAAGAAGAGTTCATCAATTTAAAGGGGCATGTGGTGAGACCATCAGTAATTGATAATATTTGCTCAGTAGCCAATCTACATAGTGAGAAAAACCGCTACCCTGATGTTGTGAATCCATCTGAAAGTGTATCTAGATTCATAGCCACTCA...

CDS

Download CDS FASTA

873 bp · TkA01G626880|TK1151|CDS

ATGTCCACTGGATTCCCACCAAATCCACCACTAAAACTCGAAGAACTCCATCACTGTACCCAAGCTCTCAAGTTTTTCAAGGAGAAACGGACTCACCAGTTATCACTTATTAAAGAAGAGTTCATCAATTTAAAGGGGCATGTGGTGAGACCATCAGTAATTGATAATATTTGCTCAGTAGCCAATCTACATAGTGAGAAAAACCGCTACCCTGATGTTGTGAATCCATCTGAAAGTGTATCTAGATTCATAGCCACTCA...

Protein

Download Protein FASTA

290 aa · TkA01G626880|TK1151|PROTEIN

MSTGFPPNPPLKLEELHHCTQALKFFKEKRTHQLSLIKEEFINLKGHVVRPSVIDNICSVANLHSEKNRYPDVVNPSESVSRFIATQGPLPETFDDFWEMVVENRCPAIVMLTRLDDGDEIDKCDDYFQAENGVRLFRNNLQTITKKITTTNSLLVLSELEVNHGEDGHHPVFHIQYPEWPDQGVPTDTSAIRDIFRRLRHLPSSKGPILVHCSAGVGRTGTYCVIHNTIQRVLIGDMSALDLVETIITFRSQRMRMVQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G626880`
TK1151 ID	TkA01G626880
OH-1004 ID	LXL04_000232
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.700
Protein coverage (%)	TK1151 100.000 / OH-1004 85.082 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G626880

Location Chr01:158232262-158233823 (+)

Description Similar to PTP1: Protein-tyrosine-phosphatase PTP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71860`	Protein-tyrosine-phosphatase that dephosphorylates and probably inhibits MPK6 in non-oxidative stress conditions.	ATMPK4, an Arabidopsis homolog of mitogen-activated protein kinase, is activated in vitro by AtMEK1 through threonine phosphorylation.2000 · DOI: 10.1104/pp.122.4.1301 MAP kinase phosphatase1 and protein tyrosine phosphatase1 are repressors of salicylic acid synthesis and SNC1-mediated responses in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067678 Molecular characterization of a tyrosine-specific protein phosphatase encoded by a stress-responsive gene in Arabidopsis.1998 · DOI: 10.1105/tpc.10.5.849

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000232 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001933 negative regulation of protein phosphorylation Biological Process

GO:0003084 positive regulation of systemic arterial blood pressure Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0009968 negative regulation of signal transduction Biological Process

GO:0010460 positive regulation of heart rate Biological Process

GO:0010812 negative regulation of cell-substrate adhesion Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030100 regulation of endocytosis Biological Process

KEGG gene cross-reference

ath:AT1G71860

gga:395688

hsa:5770

rno:24697

rno:306281

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · TkA01G626880 · TK1151

Nucleus0.282

Rank 2 · TkA01G626880 · TK1151

Cell membrane0.204

Rank 3 · TkA01G626880 · TK1151

Mitochondrion0.076

Rank 4 · TkA01G626880 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA01G626880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782DSPc20-31 aa

PF00102Y_phosphatase64-74 aa

PF00102Y_phosphatase79-272 aa

PF14566PTPlike_phytase86-104 aa

PF13350Y_phosphatase3169-227 aa

PF22785Tc-R-P181-223 aa

PF14566PTPlike_phytase188-227 aa

PF22784PTP-SAK190-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G626880	`PF00782`	DSPc	20	31	9.6e-05	22.9
TkA01G626880	`PF00102`	Y_phosphatase	64	74	2e-55	188.7
TkA01G626880	`PF00102`	Y_phosphatase	79	272	2e-55	188.7
TkA01G626880	`PF14566`	PTPlike_phytase	86	104	0.00015	22.6
TkA01G626880	`PF13350`	Y_phosphatase3	169	227	1.3e-05	26.0
TkA01G626880	`PF22785`	Tc-R-P	181	223	7.4e-07	30.4
TkA01G626880	`PF14566`	PTPlike_phytase	188	227	0.00015	22.6
TkA01G626880	`PF22784`	PTP-SAK	190	227	7.9e-06	26.7
TkA01G626880	`PF00782`	DSPc	192	227	9.6e-05	22.9
TkA01G626880	`PF22741`	PTP-NADK	204	225	0.0049	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82656`	Arabidopsis thaliana	sp\|O82656\|PTP1_ARATH Protein-tyrosine-phosphatase PTP1	51.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card