TkA01G621790 | RubberDandelionOmics

Gene overview

TkA01G621790

Reference: TK1151 Chr: Chr01 Coordinates: 156911161-156915280 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · TkA01G621790|TK1151|cDNA

AAAAAACATCCCCTACAACAGAAAAGAAGGAAAGAAAAGATGCTGACATTATCCCCTCTGCACTCAACTACCTACGGATGGCCCTCACAAGATTTCATCCAGAATCAGTCGAATTGCACTGATATTTCAATAGAAGCTGAAGCAAATTCATATAAATCATTTCTTGATTTCCATACATATAATGATATCCATCAAGATTTTGCCAATGAAAATTCAACATCTTCTGGCGGGATTGCAAATGGCGATTTTAGTAACCCTAT...

CDS

Download CDS FASTA

813 bp · TkA01G621790|TK1151|CDS

ATGCTGACATTATCCCCTCTGCACTCAACTACCTACGGATGGCCCTCACAAGATTTCATCCAGAATCAGTCGAATTGCACTGATATTTCAATAGAAGCTGAAGCAAATTCATATAAATCATTTCTTGATTTCCATACATATAATGATATCCATCAAGATTTTGCCAATGAAAATTCAACATCTTCTGGCGGGATTGCAAATGGCGATTTTAGTAACCCTATGTTGAAAAAGCTCAATCATAATGCCAGTGAAAGACATCG...

Protein

Download Protein FASTA

270 aa · TkA01G621790|TK1151|PROTEIN

MLTLSPLHSTTYGWPSQDFIQNQSNCTDISIEAEANSYKSFLDFHTYNDIHQDFANENSTSSGGIANGDFSNPMLKKLNHNASERHRRKRVNDLYAFLRSVLPISSDQKKKISIPGTVSRALKYIPELEKEIATLIRKKEKLSSDSSSKDNLGQQGMKNKIGKDAKVETKPSVVSSVSVLEAKEAVIQLISSNEDMKKRKEIGFLSRVLEYLEQEEDEFVLMNATTFKCFGEETSFSTLHLQVQGDNSIDAERLKEKLCS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G621790`
TK1151 ID	TkA01G621790
OH-1004 ID	LXL04_000299
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 89.630 / OH-1004 86.121 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G621790

Location Chr01:156911161-156915280 (-)

Description Similar to ORG2: Transcription factor ORG2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56970`	Transcription factor ORG2.	No verified direct reference in this release
`At3g56980`	Transcription factor ORG3.	No verified direct reference in this release
`At2g41240`	Plays a role in metal homeostasis.	Expression differences for genes involved in lignin, glutathione and sulphate metabolism in response to cadmium in Arabidopsis thaliana and the related Zn/Cd-hyperaccumulator Thlaspi caerulescens.2008 · DOI: 10.1111/j.1365-3040.2007.01764.x
`At5g04150`	Transcription factor bHLH101.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WZ60`	Transcription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000299 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010106 cellular response to iron ion starvation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0071731 response to nitric oxide Biological Process

KEGG gene cross-reference

ath:AT2G41240

ath:AT3G56970

ath:AT3G56980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · TkA01G621790 · TK1151

Cytoplasm0.124

Rank 2 · TkA01G621790 · TK1151

Cell membrane0.029

Rank 3 · TkA01G621790 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA01G621790 · TK1151

Plastid0.012

Rank 5 · TkA01G621790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28522ELL1_C36-61 aa

PF00010HLH76-129 aa

PF23177bHLH_IRO382-145 aa

PF23177bHLH_IRO3186-200 aa

PF00010HLH190-213 aa

PF28522ELL1_C237-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G621790	`PF28522`	ELL1_C	36	61	0.14	13.1
TkA01G621790	`PF00010`	HLH	76	129	7.2e-12	45.7
TkA01G621790	`PF23177`	bHLH_IRO3	82	145	0.023	15.8
TkA01G621790	`PF23177`	bHLH_IRO3	186	200	0.023	15.8
TkA01G621790	`PF00010`	HLH	190	213	7.2e-12	45.7
TkA01G621790	`PF28522`	ELL1_C	237	265	0.14	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1K1`	Arabidopsis thaliana	sp\|Q9M1K1\|ORG2_ARATH Transcription factor ORG2	36.700%	Swiss-Prot	Medium
`Q9M1K0`	Arabidopsis thaliana	sp\|Q9M1K0\|ORG3_ARATH Transcription factor ORG3	35.400%	Swiss-Prot	Medium
`Q9ZVB5`	Arabidopsis thaliana	sp\|Q9ZVB5\|BH100_ARATH Transcription factor bHLH100	33.800%	Swiss-Prot	Medium
`Q9FYE6`	Arabidopsis thaliana	sp\|Q9FYE6\|BH101_ARATH Transcription factor bHLH101	35.900%	Swiss-Prot	Medium
`A2WZ60`	Oryza sativa subsp. indica	sp\|A2WZ60\|IRO2_ORYSI Protein IRON-RELATED TRANSCRIPTION FACTOR 2	35.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card