TkA01G621540 | RubberDandelionOmics

Gene overview

TkA01G621540

Reference: TK1151 Chr: Chr01 Coordinates: 156853138-156855794 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

725 bp · TkA01G621540|TK1151|cDNA

GTTGGTTATACATTGAGCTAAATGGAACCGCCTTTTACCCTCTCTCTCTCTCTCTCTCCATCGCCATGGCCATGGTTAGCTCCAAGGTATTCCTGGCTGCATCGACGGTTGTTCTACTGATATCTGTGCTGTTGTCCCTCCGATTAACCACCAATAATCACTCCAGTAATGAAGACGTCGAAGTTATTCCGGTTGACGGTGGCGCAATTGGACCTGAGAGCTTCGATTTCAATCCTGTGGATGGAACTGGTCCGTACACC...

CDS

Download CDS FASTA

660 bp · TkA01G621540|TK1151|CDS

ATGGCCATGGTTAGCTCCAAGGTATTCCTGGCTGCATCGACGGTTGTTCTACTGATATCTGTGCTGTTGTCCCTCCGATTAACCACCAATAATCACTCCAGTAATGAAGACGTCGAAGTTATTCCGGTTGACGGTGGCGCAATTGGACCTGAGAGCTTCGATTTCAATCCTGTGGATGGAACTGGTCCGTACACCGGCGTTTCTGATGGTCGGATTATTAAATGGATTGCTAGCGAACAGCGGTGGACTGATTTTGCGGT...

Protein

Download Protein FASTA

220 aa · TkA01G621540|TK1151|PROTEIN

MAMVSSKVFLAASTVVLLISVLLSLRLTTNNHSSNEDVEVIPVDGGAIGPESFDFNPVDGTGPYTGVSDGRIIKWIASEQRWTDFAVTSPNREGCGGPEMEHICGRTLGLKFDEKSGHLFIADAYLGLLSVGQTGGLATSLVSKVQGNPLMFTNSLDFDQTNRFVYFTDSSQRYTRRDHMLVVLTNDKTGSLLKYDIESKEVTVILHNLTFPNGVSLSQD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G621540`
TK1151 ID	TkA01G621540
OH-1004 ID	LXL04_000303
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 39.855 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G621540

Location Chr01:156853138-156855794 (+)

Description Similar to SSL10: Protein STRICTOSIDINE SYNTHASE-LIKE 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41290`	Protein STRICTOSIDINE SYNTHASE-LIKE 2.	No verified direct reference in this release
`At3g57030`	Protein STRICTOSIDINE SYNTHASE-LIKE 10.	No verified direct reference in this release
`At1g08470`	Protein STRICTOSIDINE SYNTHASE-LIKE 3.	No verified direct reference in this release
`At3g59530`	Required for the exine formation during pollen development.	No verified direct reference in this release
`At1g74020`	Catalyzes the stereospecific condensation of tryptamine with secologanin to form strictosidine, the key intermediate of indole alkaloid biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000303 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08470

ath:AT2G41290

ath:AT3G57030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.312

Rank 1 · TkA01G621540 · TK1151

Endoplasmic reticulum0.239

Rank 2 · TkA01G621540 · TK1151

Extracellular0.186

Rank 3 · TkA01G621540 · TK1151

Cytoplasm0.171

Rank 4 · TkA01G621540 · TK1151

Cell membrane0.152

Rank 5 · TkA01G621540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20067SSL_N37-75 aa

PF03088Str_synth69-75 aa

PF08450SGL117-173 aa

PF03088Str_synth154-220 aa

PF08450SGL186-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G621540	`PF20067`	SSL_N	37	75	0.0036	17.8
TkA01G621540	`PF03088`	Str_synth	69	75	4.3e-20	72.3
TkA01G621540	`PF08450`	SGL	117	173	1.2e-05	25.8
TkA01G621540	`PF03088`	Str_synth	154	220	4.3e-20	72.3
TkA01G621540	`PF08450`	SGL	186	220	1.2e-05	25.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLG8`	Arabidopsis thaliana	sp\|Q9SLG8\|SSL2_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 2	55.300%	Swiss-Prot	High
`Q4V3D9`	Arabidopsis thaliana	sp\|Q4V3D9\|SSL10_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 10	55.600%	Swiss-Prot	High
`Q8VWF6`	Arabidopsis thaliana	sp\|Q8VWF6\|SSL3_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 3	51.700%	Swiss-Prot	High
`Q9M1B4`	Arabidopsis thaliana	sp\|Q9M1B4\|SSL13_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 13	40.800%	Swiss-Prot	Medium
`P94111`	Arabidopsis thaliana	sp\|P94111\|SSL12_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 12	38.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card