RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G619050
Reference: TK1151 Chr: Chr01 Coordinates: 156220436-156221253 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

473 bp · TkA01G619050|TK1151|cDNA

CCCGGCTCACGTTATCAGTCCATACCACTACCCGCTTACATAGCACCCACCCCTTATCAAATCGCAATGCCAACCTTAGCTTCTTATCCTGCGCTCCTCCTCCGCCTTCTTCTCCAACAGGGCCTAGGGTTTCTTTTTCTCTCTCTATTCCCAATAAAATTCATTCTTGTCTTCACAACCCCACGGTTTCACTTCCTCCACACTGCTGCCGCTTTCGAACACCCCATGGACTCGGATCGCAATATCAGGAACTCGTATAA...

CDS

Download CDS FASTA

315 bp · TkA01G619050|TK1151|CDS

ATGCCAACCTTAGCTTCTTATCCTGCGCTCCTCCTCCGCCTTCTTCTCCAACAGGGCCTAGGGTTTCTTTTTCTCTCTCTATTCCCAATAAAATTCATTCTTGTCTTCACAACCCCACGGTTTCACTTCCTCCACACTGCTGCCGCTTTCGAACACCCCATGGACTCGGATCGCAATATCAGGAACTCGTATAACTATTCTAATCTCTTCAATCTTGAGTCTCTGACGAAATTCAACTACCTCAAGGGTGATAGTTTGAT...

Protein

Download Protein FASTA

104 aa · TkA01G619050|TK1151|PROTEIN

MPTLASYPALLLRLLLQQGLGFLFLSLFPIKFILVFTTPRFHFLHTAAAFEHPMDSDRNIRNSYNYSNLFNLESLTKFNYLKGDSLIIMSNSSQGESRGSRGGP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G619050
TK1151 IDTkA01G619050
OH-1004 IDLXL04_000339
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)79.700
Protein coverage (%)TK1151 61.538 / OH-1004 4.260
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G619050
LocationChr01:156220436-156221253 (-)
DescriptionSimilar to INO80: Chromatin-remodeling ATPase INO80
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000070 mitotic sister chromatid segregation Biological Process
GO:0000723 telomere maintenance Biological Process
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0006275 regulation of DNA replication Biological Process
GO:0006281 DNA repair Biological Process
GO:0006282 regulation of DNA repair Biological Process
GO:0006302 double-strand break repair Biological Process
GO:0006338 chromatin remodeling Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0010571 positive regulation of nuclear cell cycle DNA replication Biological Process
KEGG gene cross-reference
ath:AT3G57300
cim:CIMG_06054
hsa:54617
mmu:68142
uma:UMAG_00751
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.314
Rank 1 · TkA01G619050 · TK1151
Cytoplasm0.250
Rank 2 · TkA01G619050 · TK1151
Endoplasmic reticulum0.164
Rank 3 · TkA01G619050 · TK1151
Mitochondrion0.162
Rank 4 · TkA01G619050 · TK1151
Cell membrane0.132
Rank 5 · TkA01G619050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser