TkA01G618440 | RubberDandelionOmics

Gene overview

TkA01G618440

Reference: TK1151 Chr: Chr01 Coordinates: 156056799-156063825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5224 bp · TkA01G618440|TK1151|cDNA

ACCATCTCCGTTTGGGAAAGCCCCTGTACACAGAGGCAGAACAACGGTTGTTCGATCATAATAAAGGATCGAAGCTGCTCTTGGGTTCAAAAAGGAAATACCCAGGCTCACGTTATCAGTCCATACCCACTACCCGCTTACATTAGCACCCACCCCTTATCAAATCGCAATGCCAACCCTTAGCTTCTTATCCTGCGCCCCTCCTCCGCCTTCTTCTCCAACAGGCCTAGGGTTTCTTTTTCTCTCTCTATTCCAAATAA...

CDS

Download CDS FASTA

804 bp · TkA01G618440|TK1151|CDS

ATGGTCTTAGATGAAGCTCAGGCAATCAAAAGTGCAACCAGTATAAGATGGAAGACACTACTGAGCTTTAATTGTCGGAACCGTTTGCTTCTAACTGGAACACCAATTCAGAACAACATGGCTGAGTTGTGGGCCCTTCTTCATTTCATCATGCCTACTCTATTTGACAGCCATGAACAATTCAACGAATGGTTTTCTAAAGGTATTGAAAATCATGCGGAACATGGTGGGGCTTTAAATGAGCACCAACTTAGCAGATT...

Protein

Download Protein FASTA

267 aa · TkA01G618440|TK1151|PROTEIN

MVLDEAQAIKSATSIRWKTLLSFNCRNRLLLTGTPIQNNMAELWALLHFIMPTLFDSHEQFNEWFSKGIENHAEHGGALNEHQLSRLHAILKPFMLRRVKKDVVSELTRKTEVTVHCKLSSRQQAFYQAIKNKISLAELFDSNRGQLNEKKFMNLMNIVIQLRKVCNHPELFERNEGTSYLYFGDIPNQLLPPPFGELEDVYYAGSKNPITYKIPKLIYQEIMRNSDIFSLEGRGKRGIKREFFEKYFNIFTPSHIHHSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G618440`
TK1151 ID	TkA01G618440
OH-1004 ID	LXL04_000339
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 99.625 / OH-1004 17.985 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G618440

Location Chr01:156056799-156063825 (-)

Description Similar to INO80: Chromatin-remodeling ATPase INO80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57300`	ATPase component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and DNA repair (By similarity).	The INO80 protein controls homologous recombination in Arabidopsis thaliana.2004 · DOI: 10.1016/j.molcel.2004.09.034 Epigenetic silencing of a multifunctional plant stress regulator.2019 · DOI: 10.7554/elife.47835

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010571 positive regulation of nuclear cell cycle DNA replication Biological Process

KEGG gene cross-reference

ath:AT3G57300

cim:CIMG_06054

hsa:54617

mmu:68142

uma:UMAG_00751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.566

Rank 1 · TkA01G618440 · TK1151

Cytoplasm0.378

Rank 2 · TkA01G618440 · TK1151

Mitochondrion0.105

Rank 3 · TkA01G618440 · TK1151

Cell membrane0.031

Rank 4 · TkA01G618440 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA01G618440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00176SNF2-rel_dom1-171 aa

PF30450SymE_C95-101 aa

PF30450SymE_C117-124 aa

PF30450SymE_C158-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G618440	`PF00176`	SNF2-rel_dom	1	171	2.2e-46	159.0
TkA01G618440	`PF30450`	SymE_C	95	101	3.8	7.8
TkA01G618440	`PF30450`	SymE_C	117	124	3.8	7.8
TkA01G618440	`PF30450`	SymE_C	158	166	3.8	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXS6`	Arabidopsis thaliana	sp\|Q8RXS6\|INO80_ARATH Chromatin-remodeling ATPase INO80	82.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card